KEGG   Bacillus anthracis HYU01: HYU01_05420Help
Entry
HYU01_05420       CDS       T03394                                 

Definition
(GenBank) glycerol transporter
  KO
K02440  glycerol uptake facilitator protein
Organism
banh  Bacillus anthracis HYU01
Brite
KEGG Orthology (KO) [BR:banh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:banh02000]
    HYU01_05420
Transporters [BR:banh02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    HYU01_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AIF55421
LinkDB All DBs
Position
1001842..1002663
Genome map
AA seq 273 aa AA seqDB search
MSAFLGELIGTALLIVLGGGVCAGVSLKKSFAKDSGWIVITMGWGLAVAVAAYVVGSISG
AHLNPALTIGLAFKGAFPWGDVPGYIAAQMIGAIIGAVIVYLHYLPHWKETEDPGTKLGV
FATGPAIPTTFANLLSEMIGTFVLVFGILAIGANKFADGLNPFIVGFLIVSIGLSLGGTT
GYAINPARDLGPRIAHFFLPIAGKGGSNWKYAWIPVVGPILGGSLAGLFHQVVFEGKQNA
ALIYVIIATVIVLAISYMTSKKSGSNTNSRKVA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatttttaggagagttaatagggactgcgttgttaatcgtacttggtggcggc
gtttgtgctggtgtaagtttaaagaagtcgtttgcgaaagattctggttggattgttatt
acaatgggctggggcttagcggtagcggttgcagcgtacgtggttggatcaattagtggg
gcacatttgaatccagctttgacgataggattagcatttaagggagcgttcccatggggt
gacgtacctggttatatcgcagcacaaatgattggggcaattatcggggcagttatcgta
tatttacattacttaccacactggaaagaaacagaagatccaggaacaaagttaggtgta
tttgcaacaggtccagcaattccgaccacatttgcaaaccttttaagtgaaatgattggg
acattcgttttagtatttggtatattagcaattggtgcaaataaatttgcagatggatta
aatccatttatcgtaggtttcttaattgtaagtattggtttatcattaggtggaacgaca
ggatacgcaatcaacccagcacgtgatttaggtccgcgtatcgcgcacttcttccttccg
attgcaggaaaaggcggttcaaactggaagtatgcatggattccagtagtaggtccgatt
ttaggtggatcacttgcaggattattccatcaagttgtatttgaaggaaaacaaaatgca
gcacttatttatgtgattattgcaactgtgattgtattagcaatctcttatatgacaagc
aaaaaaagtggaagcaatacaaatagtagaaaagtagcataa

DBGET integrated database retrieval system