KEGG   Bacillus anthracis HYU01: HYU01_07550Help
Entry
HYU01_07550       CDS       T03394                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
banh  Bacillus anthracis HYU01
Brite
Enzymes [BR:banh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HYU01_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DNA_gyraseB DUF2564
Motif
Other DBs
NCBI-ProteinID: AIF55819
UniProt: A0A384LIH7
LinkDB All DBs
Position
1396220..1397134
Genome map
AA seq 304 aa AA seqDB search
MSQQGVFTDYFHEVESWCESVLHVLDSRAMEVYDVHMLAYKIQTLLDRMKEHEYDTDAEF
MYEISDDVEHIQHHLQEVFVQGEEEYELCERGDSERAVPIGGHTLPPLPYPYNALEPYIS
REIMMLHHDKHHRSYVEGLNKAEKMMEEARKTNQFDLIKHWEREAAFHGSGHYLHTIFWN
NMKKGGGGSPRGALSHRIEQDFGSFLRFQKHFTEAASKVEGSGWAILVWVPRSGRLEILQ
STLHQLFTQWDTIPLLVLDVWEHAYYLQYQNRKDEYIKNWWNVVNWPDVEKRFESAKQIE
WTPY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaaggtgtatttacagattactttcatgaagtagaaagctggtgtgaaagt
gttcttcacgtattagatagccgtgcaatggaagtgtatgatgtccatatgcttgcttat
aaaattcaaacgttattagatcgtatgaaagaacatgagtacgacacagatgcagagttt
atgtatgaaataagtgatgatgtagaacatattcagcatcatttgcaagaagtatttgta
cagggagaagaggaatatgaactatgtgaaagaggggatagtgaacgagctgttccaatt
ggaggacatacactcccaccattaccgtatccgtataacgccttagaaccatatatttct
agagaaattatgatgttacaccatgataaacatcatcgtagttacgtagaaggattaaat
aaagcggagaagatgatggaagaagcgagaaaaacaaatcaatttgatttaattaagcat
tgggaaagggaagctgcttttcatggatctggtcattacctgcacacaatattttggaat
aacatgaaaaaaggtggaggcggaagtccaagaggggctctttcacaccggattgaacaa
gattttggaagtttcttacgttttcaaaaacattttacagaagcagcttctaaagtggaa
ggatcaggctgggcaattctcgtttgggtgccacgatctggaaggttagaaattttgcag
agtacacttcatcaattatttacacaatgggatacgataccactccttgtattagacgtg
tgggaacatgcgtattatttacaataccaaaatcgtaaagatgaatatataaaaaattgg
tggaatgttgtaaattggcctgatgtcgaaaaaagatttgaaagtgcaaaacaaattgaa
tggacaccgtattag

DBGET integrated database retrieval system