KEGG   Bacillus anthracis HYU01: HYU01_10400Help
Entry
HYU01_10400       CDS       T03394                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00473  D-Alanine metabolism
banh01100  Metabolic pathways
banh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:banh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HYU01_10400
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HYU01_10400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:banh01011]
    HYU01_10400
Enzymes [BR:banh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HYU01_10400
Peptidoglycan biosynthesis and degradation proteins [BR:banh01011]
 Precursor biosynthesis
  Racemase
   HYU01_10400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker DUF4170
Motif
Other DBs
NCBI-ProteinID: AIF56328
UniProt: A0A0F7RF98
LinkDB All DBs
Position
1933584..1934810
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGINQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDV
MMTVYRSEDLQGINEIANRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMEPSNTFQNMV
RVGIGIYGMYPSKEVNHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacataatgtaaaa
gaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcaggaataaatcag
cttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaattaacgtgccg
attttaattttaggctatacatcagtagcggctgcggaagaagcaattcaatatgacgtt
atgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgcaaaccgtctt
caaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcattggtttacag
gaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgtagaggtagtg
ggaatgtttacacattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcatattccatat
attcatagttcaaatagtgcaggttcaatggaacctagcaatacatttcaaaatatggtt
cgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcattcagttgtt
tcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcatgcgaagaaa
aatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatggattgccacc
gtaccgattggttatgctgatggttataatcgtcagttgtctaataaagggcatgcatta
ataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctcatgttagac
gtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggtaaacaaggc
gaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaactatgaagtt
acatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaaacaactgct
gttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system