KEGG   Bacillus anthracis HYU01: HYU01_22650Help
Entry
HYU01_22650       CDS       T03394                                 

Definition
(GenBank) preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
banh  Bacillus anthracis HYU01
Pathway
banh02024  Quorum sensing
banh03060  Protein export
banh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:banh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HYU01_22650
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HYU01_22650
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HYU01_22650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:banh02044]
    HYU01_22650
Secretion system [BR:banh02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HYU01_22650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 Chordopox_G3 PDZ DUF2615
Motif
Other DBs
NCBI-ProteinID: AIF58580
UniProt: A0A1T3UZY9
LinkDB All DBs
Position
complement(4209045..4209305)
Genome map
AA seq 86 aa AA seqDB search
MNAGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESVD
ETKIVIKSGGSHLTFDRNAIREVVKN
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgatgaatatcgttatgatcgttgcgatgtttgcgattttctatttc
ttattaattcgcccgcaacaaaagcgtcaaaaagcagttgctcaaatgcaaagtgagtta
aaaaaaggtgatgctatcgtaacaatcggtggtttacacggtacaatcgaatcagtagat
gagacgaaaatcgttattaaatctggtggctcacacttaactttcgatcgtaatgcgatt
cgtgaagttgtgaaaaactaa

DBGET integrated database retrieval system