KEGG   Bifidobacterium animalis RH: EN10_05605Help
Entry
EN10_05605        CDS       T03481                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
banm  Bifidobacterium animalis RH
Brite
KEGG Orthology (KO) [BR:banm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:banm01001]
    EN10_05605
Enzymes [BR:banm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EN10_05605
Protein kinases [BR:banm01001]
 Serine/threonine kinases: Other
  Bacterial family
   EN10_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Haspin_kinase Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AIA33102
LinkDB All DBs
Position
1275675..1277900
Genome map
AA seq 741 aa AA seqDB search
MVDTTAHGTDHYNLIDGRYRIVRKIADGGMATVYQTVDERLGRNVAVKIMHMQLAQGPHR
EQFIERFRREAKSAAAIANPHVVQVYDTGETNGSYYLVMEYVHGVNLRSQMQTHTTFSVR
DTLRIVGETLNGLAAAHEIGVVHRDIKPENILINDRGHVEITDFGLAKAASQATLSSTGM
LLGTAAYLAPEMIENNQATPQGDCYSVGIMAWELLAGRVPFQSDNPVTMVFRHVNENIPS
IGTVCYGIDPRVSAFISYLTARDVNARPKSAQKALDRLRELMPTLSRQALDYRFRPQEPP
INSTRVFPMGANEQDSDRPSVSSKSDSPEESTPPPTSAAALFTALASPDLTEEEAEQART
VALATPPDDSSTPGSGVPASGGTTVPPYGGSTGSYGRNSGRPGEPGAPLPSNAQTQVQPR
KKHRTAMIVSIIAAILALGAGGGFALWYFVGPGSYWTLPKPEGLSCAENAPCKITGVKWD
AYERLLKVSQIPYKSTQQYSDTVPAGEIISTDPQFVDAHVSKRASGEVHVTVSQGVQQAT
VPEGIMSSSSPLDDLRKAGFTNITHSEDNDEYSESVPEGEVIDITPSAGTTQNHNDDVVV
TLSKGPMPVAMPNVVGMTRGQAQKSFDDAKLKATYTEEYSDTIPRDQVISVDPEAGTQLH
WGDAVTVTVSKGPEMVTVPDITGKKTEEARKILEDLGFEVKVSSPLGDLLHTVRFQDPKG
GQQVRLRGEDGKKTVITLTVI
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggtggataccacggcacacggcacggaccactacaatctcattgacggccgctaccgc
attgtgcgcaagatcgcggatggcggcatggccacggtgtaccagaccgtcgacgaaagg
ctcgggcgcaatgtggcggtcaaaatcatgcacatgcagctggcccagggcccccaccgc
gagcagttcatcgagcgcttccgacgggaggccaaatccgcggcagcaatagccaatccg
catgtggtgcaggtgtacgacaccggtgagacgaatggctcgtactatctggtcatggag
tatgtgcacggcgtgaatctgcgtagtcagatgcagacgcacaccacgttctcggtgcgc
gacaccctgcgcatcgtcggcgagacattgaacggacttgccgccgcccacgagatcggc
gtcgtacaccgcgacatcaagccggagaacattctgatcaacgaccgcggtcatgtggag
atcaccgatttcggcctagccaaggccgcctcgcaggccacgctctcctccaccgggatg
ctgcttggcacagcggcctatctcgccccggagatgatcgaaaacaaccaggccactcct
cagggcgactgctattccgtgggcatcatggcatgggagctgctggcggggagggtgccg
ttccagtcagacaatccggtgacgatggtgttcaggcacgtcaacgagaacatcccctcc
ataggaacggtgtgctacggcatcgacccccgggtttcggccttcatctcgtacctgacc
gcacgtgacgtcaatgcccgtccgaaaagcgcacagaaggcgttggatcgcctccgtgag
ctcatgcccacgctgagccgccaggcattggactatcgcttccgcccccaggaaccaccc
atcaacagcactcgggtgttcccaatgggtgcgaatgagcaggattccgaccgtccctcc
gtttcgagcaaatcggattcgccggaagaatccactccaccacctacctctgccgccgcg
cttttcactgcattggcctcccccgatctcactgaagaggaggcggaacaggcaagaacg
gtagctctcgccacaccgccggacgactcctcgacgccaggctctggggttccggcctcc
ggtggaaccaccgttccaccatatggaggctctaccggaagttatgggcgtaattccggc
cgtcccggcgagccaggtgcgccattgcccagcaatgcccagacgcaagtgcagcctcgc
aagaagcatagaacggcgatgatcgtttcgatcatcgccgccatactcgcattgggtgcc
ggtggcggattcgcattgtggtacttcgtggggcctggcagctactggacactgcccaaa
cccgaggggctcagttgtgccgaaaatgcgccatgcaagatcacaggtgtgaaatgggat
gcctatgagcgtctgctcaaagtctcgcagattccgtacaaaagcacacagcagtatagc
gacacagtgcctgccggcgagatcatctccaccgacccgcaatttgtggatgcccatgtg
agcaagcgggccagcggcgaggtgcatgtgacggtgtcgcaaggtgtgcagcaggccacc
gttcccgaaggcatcatgagcagctcgtcccctctggacgacctgcggaaggcgggcttc
accaacatcacgcacagcgaagacaacgacgagtattccgaaagcgttccggaaggcgag
gtcatcgacatcacgcccagcgccggcaccacacagaaccataacgacgacgtcgtggtg
acgctctccaaagggcccatgccggtggcaatgccgaatgtggtgggcatgacgcgcggt
caggcgcagaagtcgtttgatgacgccaagctcaaggcgacctacaccgaagagtacagc
gatacgattccacgggaccaggtgatttcagtggatcccgaggcgggaacccaattgcac
tggggcgatgcggtcacagtcaccgtctcgaagggccctgaaatggtgaccgttcccgac
atcacgggcaagaagacggaggaggccaggaagatccttgaagacctcggctttgaggtg
aaggtctcatcaccgttgggcgacctcctgcacaccgtgcgattccaagatcccaaaggc
ggccagcaggtgcgtctgcgtggcgaagacggcaagaaaacggtgatcacactcacggtg
atctga

DBGET integrated database retrieval system