KEGG   Bacillus anthracis A16R: A16R_21410Help
Entry
A16R_21410        CDS       T02999                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00473  D-Alanine metabolism
banr01100  Metabolic pathways
banr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:banr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A16R_21410
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A16R_21410
Enzymes [BR:banr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A16R_21410
Peptidoglycan biosynthesis and degradation proteins [BR:banr01011]
 Precursor biosynthesis
  Racemase
   A16R_21410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4170
Motif
Other DBs
NCBI-ProteinID: AHE83482
LinkDB All DBs
Position
1946932..1948107
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMEPSNTFQNMVRVGIGIYGMYPSKEVNH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcagga
ataaatcagcttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacatcagtagcggctgcggaagaagcaattcaa
tatgacgttatgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcatt
ggtttacaggaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgta
gaggtagtgggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcat
attccatatattcatagttcaaatagtgcaggttcaatggaacctagcaatacatttcaa
aatatggttcgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcat
tcagttgtttcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccaccgtaccgattggttatgctgatggttataatcgtcagttgtctaataaaggg
catgcattaataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctc
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaa
acaactgctgttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system