KEGG   Bacillus anthracis A16R: A16R_36060Help
Entry
A16R_36060        CDS       T02999                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
banr  Bacillus anthracis A16R
Pathway
banr00500  Starch and sucrose metabolism
banr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A16R_36060
Enzymes [BR:banr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A16R_36060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: APB61767
LinkDB All DBs
Position
complement(3256203..3257744)
Genome map
AA seq 513 aa AA seqDB search
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDRNHWNRLRTDAENL
AQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWH
DMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaaataacaatagtcggcttgtcggttgttttgtttttacctagtatatat
ggggagagtaaagtgtatgcagatacgattaacaatggaacgttaatgcagtattttgag
tggtatgctccaagtgataggaatcattggaatcgtttgcgcactgatgctgaaaattta
gcgcaaaaaggaattacatctgtttggatacctcctgcgtataaaggaactacgcaaaat
gatgtaggatatggagcatatgatttatatgatttgggtgaattcaatcaaaagggaaca
gtgcggacgaaatatgggacaaaagcacaattgaaatctgcaattgaagctttacataag
caaaacatcgatgtatacggcgatgtagttatgaatcataaaggtggagcagattatact
gaaactgtaacagctgttgaggtagaccgtaacaatcgaaatgttgaggtatcaggtgat
tatgaaattagtgcatggacagggtttaactttcctggacgtggagataattattctaat
ttcaaatggaagtggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtataggtaaagcatgggactgggaagtgtctagtgagaat
ggaaattatgattatttgatgtatgcagaccttgattttgatcatccagatgttgcgaat
gagatgaaaaattgggggacgtggtatgcgaatgaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgttaggcag
caaacggggaaagaaatgtttacggtggctgaatattggcaaaatgatatccaaacttta
aataattatttagcgaaagtcaattataatcaatctgtatttgatgcaccactgcattac
aattttcattatgcttcaaaaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgcaaaatcatcctgcactcgcagttactcttgttgagaatcatgattctcag
cctggtcagtcattggaatctgtagtaagtccgtggtttaaaccgttggcatatgcattt
attttaactcgtgcagagggatatccttcagttttttatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccgattttgacagca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattgga
tggacgagagaaggtgatagtgtacatgctaattctggtttagcaacattaatctctgat
ggaccgggaggatcaaagtggatggatgttggaaagaataatgcaggggaagtatggcat
gatatgacgggtaatcaaacaaatactgtaacaattaataaggatggatgggggcaattc
catgtaagtggaggatcagtttccatatatgttcagcagtga

DBGET integrated database retrieval system