KEGG   Bacillus anthracis A16R: A16R_47090Help
Entry
A16R_47090        CDS       T02999                                 

Definition
(GenBank) BofC protein
  KO
K06318  forespore regulator of the sigma-K checkpoint
Organism
banr  Bacillus anthracis A16R
Brite
KEGG Orthology (KO) [BR:banr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    A16R_47090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BofC_C BOFC_N
Motif
Other DBs
NCBI-ProteinID: AHE86049
LinkDB All DBs
Position
complement(4230152..4230682)
Genome map
AA seq 176 aa AA seqDB search
MKWILIAMQAFVMMFCLVYETNAKAEGPVPKVTEKEPEVTILLERMYVDGEVSEEIFTEK
VADLENILQQYKEWQLVDRDDVQIVLQKKVDDISPLLKTSGYFGVSEEGILQIFKGVPKS
DNAIHSFFQIDMKKLESYERAKLKRGIRIKSKEGFVKTIEKMKQYAVQNKKKSSSW
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatactgattgcgatgcaagctttcgttatgatgttttgtctcgtttatgaa
acgaatgcgaaggcggaagggccagtaccaaaagtaacagaaaaagaaccggaagttaca
attttattagagcgaatgtatgttgatggcgaagtaagtgaggaaatctttacagaaaaa
gtggcggatttagaaaacattttacagcagtataaagaatggcaactcgttgatcgtgat
gatgtgcaaattgtattacaaaagaaagttgatgatatttctccgttattgaaaacgagc
ggttattttggagtatcagaggaagggatattacaaattttcaaaggtgtaccgaaaagt
gataatgcgattcattccttctttcaaattgatatgaaaaagcttgagagttatgagcgt
gcgaaattgaagcgcggtattcggattaaatcaaaagaaggttttgtgaagacgattgaa
aaaatgaaacaatacgcagtgcaaaataagaaaaaaagcagctcatggtga

DBGET integrated database retrieval system