KEGG   Bacillus anthracis SVA11: BAPAT_0652Help
Entry
BAPAT_0652        CDS       T03162                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-containing protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPAT_0652
Enzymes [BR:bans01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BAPAT_0652
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BAPAT_0652
    1.1.1.-  
     BAPAT_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N CoA_trans Gp_dh_N CMAS
Motif
Other DBs
NCBI-ProteinID: AHK36829
LinkDB All DBs
Position
680425..681486
Genome map
AA seq 353 aa AA seqDB search
MYKMKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHP
LTHVKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLV
FHGLGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAV
FGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTN
SLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGY
RHIFPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagta
ccagaaccaactgtaaaaccaggagcagttaagattaaagttaaatggtgtggtatctgc
gggacagacttgcatgaatatttagcaggacctatttttattccgacagaagagcatcca
ttaacacatgtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaa
atcggtgaaggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttat
tcttgtggtaaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgtt
ttccacggtcttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagat
atggttcaccatattccagatgaaatgacgtatgaacaaggtgctcttgtagaaccagca
gcagtagcggttcatgcagtacgtcaaagtaaattaaaagaaggggaagcagtagcagtc
tttggttgtggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaact
cctgttattgcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcg
gattacgtattgaatccagcgactcaagatgtattagctgaaattcgcaacttaacaaat
agtttaggtgtaaatgtaagctttgaagtaactggtgttgaagtagtacttcgtcaagca
attgaaagcacaagctttgaaggacaaactgtaattgttagtgtatgggaaaaagacgca
acaattactccaaataatcttgtactaaaagaaaaagaagtggttggtattttaggatac
cgtcatatcttcccagctgttattaaattaattagctctggtcaaattcaagcagagaaa
ttaattacgaaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgta
aaagataaaacacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system