KEGG   Bacillus anthracis SVA11: BAPAT_0978Help
Entry
BAPAT_0978        CDS       T03162                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00564  Glycerophospholipid metabolism
bans01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAPAT_0978
Enzymes [BR:bans01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAPAT_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_oxidored GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHK37152
LinkDB All DBs
Position
1004368..1006050
Genome map
AA seq 560 aa AA seqDB search
MKFSSKQRKDVLNGVNKQELDVIVIGGGITGSGIALDGATRGLSTIVFEMQDFAAGTSSR
STKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGSFSTSI
GLRVYDFLAGVKRSERRKMFNREETLKKEPLVKQEGLKGGGYYVEYRTDDARLTIEVMKE
AIEHGAKAVNYAKVDGFLYKDGKVCGVRVIDLLDGEVYEVYGKKIVNAAGPWVDTLREKD
NSKKGKVLQLSKGVHLVIDQKRFPLGQAIYFDTPDKRMVFAIPRGGKTYVGTTDTFYDKD
AAVPQMTTEDRTYIINAINYMFPSVKITEKDIESSWAGVRPLIYEEGKSASEISRKDEIW
TSESGLITIAGGKLTGYRKMAEMVVDYVTNLLQKEGHSAYPKSSTKHMPISGGHVDGSKG
LPAFIAKKAGEGTKYGLTTAQAEEFAKFYGSNVDVLFDLAKKHKDEAKEYNMPLDVLIPL
VYAMDYEMTAKPVDFFVRRRGAVFFNIHWVYEWKEAVINYMAAKLGWSKEEQMKYTAELE
KALTDAVIPVDQQEHAAALA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtaaacaacgtaaagacgtattaaacggagtaaataaacaagaatta
gatgtgatcgtaattggtggaggtattactggttctggtattgcattagatggagcaaca
cgcgggttatcaacaattgtgtttgaaatgcaggactttgcagcaggtacatcaagtcgt
tcaacgaagcttgtacacggtggtctacgttatttaaaacaacttgaagtgaaaatggta
gcagaggtgggtaaagagcgtgcgatcgtatatgagaacggtccccatgtaacaacacca
gagtggatgttacttccgttccatacaggaggtacgttcggatcatttagtacatcaatt
ggtcttcgtgtatacgacttcttagcaggtgtaaaacgaagtgagcgcagaaaaatgttt
aaccgtgaagaaacgctgaagaaagagcctcttgtaaaacaagaaggattaaaaggtggc
ggttactacgtagaatatcgtacagacgatgcacgtcttacaattgaagtaatgaaagaa
gcaattgagcacggcgcaaaagctgttaattacgcaaaagtagacggtttcttatataaa
gatggaaaagtatgtggtgtacgtgtaatcgatttactagacggagaagtatacgaagtt
tacggtaagaaaattgtaaacgcagctggtccttgggtagatacacttcgtgaaaaagat
aactcgaaaaaaggaaaagtacttcagttatcaaaaggtgttcacttagtaattgatcaa
aaacgtttcccattaggtcaagcgatttacttcgatacaccagataaacgtatggtattc
gcgattccacgcggcggaaaaacatacgtaggtacaacagatacgttctatgataaagac
gcagctgtaccacaaatgacaacagaagatcgcacgtacatcattaatgcgattaactac
atgttcccaagcgtaaaaattacggaaaaagacatcgaatcaagctgggctggtgtacgt
ccgttaatttacgaagaaggtaagagtgcatctgaaatttctcgtaaagacgaaatttgg
acttctgaatctggtttaattacaatcgcaggtggtaaattaacaggataccgcaaaatg
gctgaaatggtagtagactacgtaacgaacttactacaaaaagaaggtcacagtgcatat
ccgaagagctcaacgaaacatatgccaatctctggtggacatgtagatggctctaaaggg
ttaccagcatttatcgcgaaaaaagcaggcgaaggtacgaaatacggtttaacaacagca
caagcagaagaattcgcgaaattctatggctctaacgttgacgtactattcgacttagca
aaaaaacataaagacgaagcgaaagaatacaacatgccactagacgttctaatcccactt
gtatacgcaatggattacgaaatgacagcaaaaccagtcgacttcttcgtacgccgcaga
ggcgctgtattcttcaacatccactgggtatacgagtggaaagaagcagtaatcaactac
atggctgcgaaactaggctggagcaaagaagaacaaatgaaatacacagctgaattagag
aaagcattaacagacgctgtcattcctgtagatcaacaagaacatgcagctgcgttagcg
taa

DBGET integrated database retrieval system