KEGG   Bacillus anthracis SVA11: BAPAT_1341Help
Entry
BAPAT_1341        CDS       T03162                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00340  Histidine metabolism
bans01100  Metabolic pathways
bans01110  Biosynthesis of secondary metabolites
bans01230  Biosynthesis of amino acids
Module
bans_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BAPAT_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2d DUF1381
Motif
Other DBs
NCBI-ProteinID: AHK37513
LinkDB All DBs
Position
1335260..1336522
Genome map
AA seq 420 aa AA seqDB search
MTKWKRANPNGTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVFAFQSRPI
DEEKMYKFFDEKGRIIVLRPDMTIPLARVVGTQRCDTPLKVTYSGNVFRANESLAGKYNE
IVQSGIEVIGIDNVRAEIECVISVIQSLQKLRVQSFTIEIGQVQLYKCIVKKLSIHEEEE
KFLRTYIESKNYASLSNFIRDKKLDRCDETVKLLEKLPRLFGNLEVIEEAEKLASSNEMK
MAITRVKEIYEAIEKLGYGSYISIDLGMIQHLDYYTGVIFKGYIYEIGEEIVSGGRYDEL
IGNFGEMLPAVGLAVQVNQIVKALQEQQEPYERKRIDIMIHYELNRLAEAERLRNLLQKD
GKKVALSLFSNLNDTFQFARKNQIVTVVEAKSESLVEYVWKEKWVVQKEGETSCVTFKLR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatggaaacgggcaaacccaaatggaacgagagattatttattcgaagaatgt
acgttaattgaagaagtggagcaaaaattaaggcgtacttttttagagagaggttatgaa
gaaataaggacaccaacaattgaattttatgatgtgttcgcctttcaaagcaggccgata
gatgaagaaaagatgtataaattttttgatgaaaaggggcggattatcgtattgcgtcca
gatatgacaattcctttagcgagagtggtgggaacgcagaggtgtgatacgccacttaaa
gtgacgtatagcggaaatgtatttcgagcgaatgagtctcttgctggaaaatataatgag
attgtacaaagtggtattgaagttatcggtattgataatgtaagagctgaaattgaatgt
gttataagcgtcattcaatcacttcaaaagttaagggtgcaatcttttacaatagagatt
gggcaagtacagttatataaatgtattgtcaaaaagctctccattcatgaggaagaagag
aaatttcttagaacatatattgaaagtaaaaattatgcctctttatccaattttattaga
gataagaaattagatcgatgtgatgaaacagtaaagttactggagaaattaccgaggtta
tttgggaatttagaagtgattgaggaagcagaaaaactcgcctcaagtaatgaaatgaaa
atggctattacaagagtaaaggaaatatatgaagcaattgaaaaactaggctatggatct
tacatatcaattgatttaggaatgattcaacatttggactattatacaggtgttattttc
aaagggtatatatatgaaattggagaagaaattgttagtggaggaagatatgatgagtta
attggaaattttggagaaatgttaccggctgttggactcgcggtgcaagttaatcaaatt
gtaaaggcgctgcaagagcagcaagagccatatgaacgaaagagaatagatattatgatt
cattacgagttaaatagattagcagaagcggaacgattacgaaatttacttcaaaaggac
gggaaaaaagtagcgctatctttattctctaatttaaatgatacttttcaatttgctaga
aaaaatcaaatcgtaacggtcgttgaggcaaagagtgaatcattagtggaatatgtgtgg
aaagagaaatgggtcgtccagaaagaaggggaaacttcatgcgtaacattcaaattgcgt
taa

DBGET integrated database retrieval system