KEGG   Bacillus anthracis SVA11: BAPAT_2507Help
Entry
BAPAT_2507        CDS       T03162                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00473  D-Alanine metabolism
bans00550  Peptidoglycan biosynthesis
bans01100  Metabolic pathways
bans01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAPAT_2507
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAPAT_2507
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BAPAT_2507
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bans01011]
    BAPAT_2507
Enzymes [BR:bans01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BAPAT_2507
Peptidoglycan biosynthesis and degradation proteins [BR:bans01011]
 Precursor biosynthesis
  Amino acid ligase
   BAPAT_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AHK38661
LinkDB All DBs
Structure
PDB: 

Position
2418033..2418968
Genome map
AA seq 311 aa AA seqDB search
MKFGVEEMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDI
DFALLALHGKYGEDGTAQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWI
ELTKMEDLNFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEK
YIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASL
ACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIE
TSLRVRKEEGF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttggagttgaggaaatgagaattggcgttattatgggaggagtatcctctgaa
aaacaagtatcaattatgactggaaacgaaatgattgcaaatttagataaaaataaatat
gaaatcgtaccaattacgttaaatgaaaaaatggatttaatcgaaaaagcgaaagacatt
gattttgcgctgctcgcattacacggaaaatacggagaagatgggacagctcaaggaacg
cttgaaagtttaggtattccttatagcggcagcaatatgttatctagcggtatatgtatg
gacaaaaatatttcgaaaaagattttacgttatgaaggaatagaaacgccagattggatt
gaacttacaaaaatggaggatttgaattttgatgagttagataagttaggatttccatta
gtggtaaaaccaaactctggtggttcaagtgttggggtaaagattgtctatgataaagac
gaattaatttcaatgctggaaactgtgttcgaatgggattctgaagtagtaatagagaaa
tatataaaaggtgaagagattacatgttccatttttgatgggaaacagttacctatcatt
tcaattcggcatgcggctgagttctttgattacaatgcgaaatatgatgacgctagtaca
attgaagaagttatcgaacttccagctgaacttaaggaacgtgtaaacaaagcatcactg
gcgtgctataaagcattaaaatgtagtgtttatgcaagggttgatatgatggtgaaggac
ggtattccatatgtaatggaggttaatacattaccagggatgacacaagcaagtttacta
ccaaaaagtgcagatgcagcgggaattcattatagtaaactattagatatgattattgaa
acttcattaagagtaagaaaagaagaagggttttaa

DBGET integrated database retrieval system