KEGG   Bacillus anthracis SVA11: BAPAT_3834Help
Entry
BAPAT_3834        CDS       T03162                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bans  Bacillus anthracis SVA11
Brite
KEGG Orthology (KO) [BR:bans00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bans01001]
    BAPAT_3834
Enzymes [BR:bans01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BAPAT_3834
Protein kinases [BR:bans01001]
 Serine/threonine kinases: Other
  Bacterial family
   BAPAT_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Haspin_kinase Kinase-like ETRAMP Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AHK39968
LinkDB All DBs
Position
complement(3660578..3662506)
Genome map
AA seq 642 aa AA seqDB search
MIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREAQSVTTLSHPNIVNMY
DVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTSAMAHAHHFEIVHRDI
KPHNILIRADGVIKVTDFGIATATSATTITHTNSVLGSVHYLSPEQARGGIANKQSDIYS
LGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNENIPQSVENIILKATAKDPFH
RYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQLFENVTDETIVLKGS
KVDEQIRKEETDLSKKKKRSNKWLKILITTFLLLAIGITLALTVIPGFFIPKDVKVPDVA
GMKYTTAVNTLVEKGFEVTEPNIVYTDDVETGDVIKTDPVAGRVVKENSKITIYQSGGKK
KSKMIDFTGKDLESIRTELEEKYKQVTVYYIEDDRPKGAIVEQIPTSDQMVVEAEQELKI
WVSKGPYQIRPGDFSRWTENSVTGYLNERKLTPDIKREYSDTVDKGLVISQSPKPGTPLK
EGDKVTIIISEGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEIYKEDMQQKMDRPIET
RTISESATISLEFVIQEDTKGRYKIVRDGVTIIDKEVPYPTQ
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgattggtggcggtggaatggccaatgtgtatttagctcatgatgatatactgggccgg
gatgtagcggtgaaaatattaagactcgactattcaaataacgaagagtttattaaacgt
ttccatcgagaagcgcagtctgttacaacgttgtcgcatccaaatattgtgaatatgtat
gatgtcggagaagaggatggtatatattatcttgtaatggagtatgtaccaggacaaaca
ttgaagcaatacataattgagcgagggatgttacctattggagaagctcttgacataatg
gagcagttaacatccgccatggcacatgcccatcattttgaaattgtgcaccgtgatatt
aaaccgcacaatattttaattcgagctgatggagtaataaaagtaacagattttggaatt
gcgacagctacaagtgcaacaacaattacacatacaaattcagtactcggttcggtgcat
tatttatcaccagaacaagcacgcggtgggatagcaaataaacaatcagatatttattcc
ctagggatcgttatgtttgagttgttaacaggaagacaaccgttttctggcgaatctgct
gttgctatagctttaaaacatttacaaagtgaaattccatctccaaaaagatggaatgaa
aatattcctcaaagtgtcgaaaatattatattaaaggcaactgcgaaagatccatttcat
cgatatcaatctgccaatgcgatgaaacgagatattgaaactgcgctatatccagagagg
ataaatgagcagccattttacataccggaagatatggaagcgacaaaagcgattccgatt
attcaacaagaacaattattcgaaaatgttactgatgaaacaattgttttaaaaggaagt
aaagtggatgaacagataagaaaagaagaaacggatttaagtaagaagaaaaaacgaagt
aataaatggctcaaaattttaattacaacatttttactgttagcgattggaataacgtta
gcgcttactgttattccaggattctttattccaaaagatgtaaaagtacctgatgtggct
ggtatgaaatatacgacagcagtaaatacattagttgaaaagggttttgaagttacggaa
cctaatattgtatatacagatgatgttgaaaccggtgacgttataaaaacagatcctgta
gcaggtagagtcgtgaaagaaaactctaaaattactatctatcaatcaggtgggaaaaag
aaaagtaagatgattgatttcacaggaaaagatttagagagtataagaacagagttagaa
gagaaatataaacaagttacagtatattatattgaagatgataggccgaaaggtgcaatt
gtagagcaaattccgacgtctgaccaaatggtggtagaggccgagcaagaactgaaaatc
tgggtaagtaaaggcccttatcaaattagaccgggtgatttttcaaggtggactgaaaat
agtgtaactggttatttgaatgagagaaaactaactccagatataaaacgagagtattcc
gatactgttgataaaggacttgtaatttcgcaatctccaaaaccgggaacgccgttaaaa
gaaggggataaagtgacgattatcatctcagagggccctaagccgaaagtaacgaaaacc
gtgaaagtggataatatttctattccgtatgagtcttctataataggtgagaaaaaaccg
caaacaatagaaatttataaagaagatatgcaacaaaaaatggatagaccaattgaaact
agaacaatttcagagtcggcaactatttcattagaatttgtaattcaagaagatacaaaa
ggacgctataaaattgtaagagatggtgtaacgattattgacaaagaagtaccatatcca
acacaataa

DBGET integrated database retrieval system