KEGG   Bacillus anthracis SVA11: BAPAT_4460Help
Entry
BAPAT_4460        CDS       T03162                                 

Definition
(GenBank) S-adenosylmethionine--tRNA ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
bans  Bacillus anthracis SVA11
Brite
KEGG Orthology (KO) [BR:bans00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bans03016]
    BAPAT_4460
Enzymes [BR:bans01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     BAPAT_4460
Transfer RNA biogenesis [BR:bans03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BAPAT_4460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth
Motif
Other DBs
NCBI-ProteinID: AHK40588
LinkDB All DBs
Position
complement(4208678..4209730)
Genome map
AA seq 350 aa AA seqDB search
MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGDIEHKHFTDILSYLHEGDCLVLNE
TKVMPARLHGVKEDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISFGEGKLKATCT
GTADQGGRQLEFSYDGIFYEILDELGEMPLPPYIKETLEDRDRYQTVYAKEIGSAAAPTA
GLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHMHAEYYHMSEETAALLN
RVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYPGYEFKAIDGLITNFHL
PKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGDAMFVASHAKMGNK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggatattaatctgtttgattttcatttaccagaagaacttattgcacaagtcccatta
gaagagcgtgaaacatcaagattaatggtgttagaccgcgaaacaggggatattgagcat
aaacattttacggacattctttcttacttacatgagggggattgcttagttttaaatgaa
acgaaagtaatgccagctcgtttgcacggtgtgaaagaagatacaggcgcacacattgaa
gtacttcttttaaaacaggaagaaggcgataagtgggagacgcttgttaagccagcgaaa
cgtgtaaaagaaggaactgttatctcttttggcgaagggaaattaaaagcaacttgcaca
ggaactgcagatcaaggtggacgtcagcttgaattttcatatgacggcatcttctatgaa
attttagatgaacttggagaaatgccacttcctccatatattaaagagacgctagaagat
cgcgatcgctatcaaacagtatatgcgaaagaaatcggttcagcagcagcgccaactgca
ggacttcactttacagaagagttactggagaagttaaaacaaaaaggcgttgagttagca
tttattacacttcacgtagggcttggaacatttagaccagtttctgctgatacgattgaa
gagcaccatatgcatgcagaatattaccatatgtctgaagagacagcggcattattaaac
cgtgtaaaagagaatggtggacgtattattacggtaggtacgacttcaactcgtacgtta
gaaacaattgcgacagatcatgacggcaagctttgtgctgcttctggctggacagacatt
tttatgtacccaggttatgaatttaaagcaattgatggtttaattacaaacttccattta
ccgaaatcaacattaattatgcttgtaagtgcatttgcaaacagagataatgtacttcat
gcttataatgaagcagtaaaagaaaaatatcgtttctttagcttcggtgatgcaatgttc
gttgcatctcacgctaaaatgggaaacaaataa

DBGET integrated database retrieval system