KEGG   Bacillus anthracis SVA11: BAPAT_4639Help
Entry
BAPAT_4639        CDS       T03162                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bans  Bacillus anthracis SVA11
Pathway
bans00020  Citrate cycle (TCA cycle)
bans00480  Glutathione metabolism
bans01100  Metabolic pathways
bans01110  Biosynthesis of secondary metabolites
bans01120  Microbial metabolism in diverse environments
bans01130  Biosynthesis of antibiotics
bans01200  Carbon metabolism
bans01210  2-Oxocarboxylic acid metabolism
bans01230  Biosynthesis of amino acids
Module
bans_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bans_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPAT_4639
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAPAT_4639
Enzymes [BR:bans01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAPAT_4639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHK40767
LinkDB All DBs
Position
complement(4383534..4384841)
Genome map
AA seq 435 aa AA seqDB search
MGVITLTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKK
IVWKEVLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDL
YVCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMG
VNKIRFPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNW
GYEVAEQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLD
KVNPSSVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFA
NELIKNMDVAIIKNA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggttatcacattgacgacaggtgaaaaaattactgtaactaatggtgttatgaat
gtaccaaacaatccgattattccatttatcgaaggagatggaattggtcctgatatttgg
gcagctgcatctcgtgtactagaagcagcagttgaaaaagcttatgatggtgagaagaaa
atcgtttggaaagaagtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggtta
ccagaagaaactttaaatttaattcgtgaatatttaatcgcgattaaaggtccacttaca
actccagttggcggtggtattcgttctctaaacgtagcacttcgtcaagaattagattta
tatgtatgtctacgtccagttcgttattttgaaggtgttccttcacctgtaaaacgtccg
gaagatactgatatggttattttccgtgaaaatacagaagacatttatgctggaattgaa
tatgcgcaaggatctccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggt
gttaataaaatccgcttcccagaaacatctggtattggtattaaaccaatctcagaagaa
gggacaaagcgtcttgttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttct
gttacattagttcataaaggaaacattatgaaattcacagaaggtgctttcaaaaactgg
ggttacgaagtagcggaacaagaattcggcgacaaagtatttacttgggctgaatatgat
cgtatcgttgagaaagatggtaaagatgcagcgaataaagcgatggcagacgctgaagtg
gctggaaaaatcatcgtaaaagattctattgcagacatcttcttacaacaaattttaact
cgtccacgtgagttcgatgttgttgcaacaatgaacttaaacggagactacatctctgat
gcacttgctgcacaagtaggtggaattggtattgcacctggtgcaaacattaactatgtg
actggacatgctatctttgaagctacgcacggtacagctccaaaatatgcaggtttagat
aaagtaaacccatcttcagttcttctttctggtgtattattattagagcacttaggatgg
aacgaagctgcgaaattagtaactgcttcagttgagaaaacaattgcttcaaaagtagta
acttatgatttcgcacgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgct
aatgaacttattaaaaacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system