KEGG   Bacillus anthracis A16: A16_15330Help
Entry
A16_15330         CDS       T02998                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bant  Bacillus anthracis A16
Brite
Enzymes [BR:bant01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A16_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DNA_gyraseB DUF2564
Motif
Other DBs
NCBI-ProteinID: AHE88794
LinkDB All DBs
Position
1409611..1410525
Genome map
AA seq 304 aa AA seqDB search
MSQQGVFTDYFHEVESWCESVLHVLDSRAMEVYDVHMLAYKIQTLLDRMKEHEYDTDAEF
MYEISDDVEHIQHHLQEVFVQGEEEYELCERGDSERAVPIGGHTLPPLPYPYNALEPYIS
REIMMLHHDKHHRSYVEGLNKAEKMMEEARKTNQFDLIKHWEREAAFHGSGHYLHTIFWN
NMKKGGGGSPRGALSHRIEQDFGSFLRFQKHFTEAASKVEGSGWAILVWVPRSGRLEILQ
STLHQLFTQWDTIPLLVLDVWEHAYYLQYQNRKDEYIKNWWNVVNWPDVEKRFESAKQIE
WTPY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaaggtgtatttacagattactttcatgaagtagaaagctggtgtgaaagt
gttcttcacgtattagatagccgtgcaatggaagtgtatgatgtccatatgcttgcttat
aaaattcaaacgttattagatcgtatgaaagaacatgagtacgacacagatgcagagttt
atgtatgaaataagtgatgatgtagaacatattcagcatcatttgcaagaagtatttgta
cagggagaagaggaatatgaactatgtgaaagaggggatagtgaacgagctgttccaatt
ggaggacatacactcccaccattaccgtatccgtataacgccttagaaccatatatttct
agagaaattatgatgttacaccatgataaacatcatcgtagttacgtagaaggattaaat
aaagcggagaagatgatggaagaagcgagaaaaacaaatcaatttgatttaattaagcat
tgggaaagggaagctgcttttcatggatctggtcattacctgcacacaatattttggaat
aacatgaaaaaaggtggaggcggaagtccaagaggggctctttcacaccggattgaacaa
gattttggaagtttcttacgttttcaaaaacattttacagaagcagcttctaaagtggaa
ggatcaggctgggcaattctcgtttgggtgccacgatctggaaggttagaaattttgcag
agtacacttcatcaattatttacacaatgggatacgataccactccttgtattagacgtg
tgggaacatgcgtattatttacaataccaaaatcgtaaagatgaatatataaaaaattgg
tggaatgttgtaaattggcctgatgtcgaaaaaagatttgaaagtgcaaaacaaattgaa
tggacaccgtattag

DBGET integrated database retrieval system