KEGG   Bacillus anthracis A16: A16_43590Help
Entry
A16_43590         CDS       T02998                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bant  Bacillus anthracis A16
Pathway
bant00330  Arginine and proline metabolism
bant01100  Metabolic pathways
bant01110  Biosynthesis of secondary metabolites
bant01130  Biosynthesis of antibiotics
bant01230  Biosynthesis of amino acids
Module
bant_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bant00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    A16_43590
Enzymes [BR:bant01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     A16_43590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA Shikimate_DH Sacchrp_dh_NADP NAD_Gly3P_dh_N TTc_toxin_rep 3HCDH_RFF
Motif
Other DBs
NCBI-ProteinID: AHE91620
LinkDB All DBs
Position
3979881..3980720
Genome map
AA seq 279 aa AA seqDB search
MSIQNISFLGAGSIAEAIIGGLLHANVVKGEQITVSNRSNETRLQELHQKYGVKGTHNKK
ELLTDTNILFLAMKPKDIAEALIPFKEYIHHNVLIISLLAGVSTHSIKNLLQKDVPIIRA
MPNTSAAILKSATAISPSKHATAEHIQTAIALFKTIGLVSVVEEEDMHAVTALSGSGPAY
IYYVVEAMEAAAKKIGLKEDVAKSLILQTMIGAAEMLKASEKHPSILRKEITSPGGTTEA
GIEVLQEHKFQQALISCITQAAQRSHNLGKTLEQLTKEK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcaaaacatttcctttctcggtgcaggctctattgctgaagctattattggt
ggcttgttacatgcaaatgttgtgaaaggcgaacaaattaccgtaagtaatcgttctaac
gagacaaggttacaggagctacatcaaaaatatggagtcaaaggtacgcataataaaaaa
gaactacttactgatacaaatattctttttctagctatgaaacctaaggatattgcagaa
gcgcttatcccttttaaagaatatatacatcataacgtacttattatttcgttattagcg
ggtgtttctactcactcgattaaaaacttacttcaaaaagacgttccgattattcgagca
atgccaaatacatctgcagctattttaaaatcagctactgctatctcgccttcaaagcat
gcaacagcggaacatattcagactgccatagctttatttaaaacgatcggcctcgtctct
gttgtagaggaagaagatatgcatgctgtcactgcattatctggaagtgggcctgcttat
atttattacgtagtagaagcgatggaagcagccgcaaaaaaaatcggtttaaaagaagat
gttgcaaagtcacttattcttcagacgatgattggtgctgctgaaatgctaaaagcaagt
gaaaaacacccttctattttgcgaaaggaaattacttctcctggtggaacgaccgaagcg
ggcattgaagtattacaagaacataaatttcaacaagcacttatttcttgtattacacaa
gcagcgcaacgatcgcataacctcgggaaaacattagaacaactaacaaaagaaaaataa

DBGET integrated database retrieval system