KEGG   Bacillus anthracis A16: A16_46450Help
Entry
A16_46450         CDS       T02998                                 

Definition
(GenBank) Holliday junction DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
bant  Bacillus anthracis A16
Pathway
bant03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bant00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    A16_46450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bant03400]
    A16_46450
Enzymes [BR:bant01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A16_46450
DNA repair and recombination proteins [BR:bant03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A16_46450
    RecFOR pathway proteins
     A16_46450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 TIP49 Mg_chelatase AAA_16 Sigma54_activat AAA_22 DUF815 TsaE AAA_3 Rad17 NB-ARC AAA_18 Bac_DnaA IstB_IS21 RNA_helicase NTPase_1 Sigma54_activ_2 AAA_24 TniB AAA_14 MCM Resolvase RsgA_GTPase AAA_17 NACHT AAA_28 ABC_tran ATPase_2 AAA_25 AAA_33 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AHE91905
LinkDB All DBs
Position
complement(4227432..4228433)
Genome map
AA seq 333 aa AA seqDB search
MDERLLSGESAYEDADLEYSLRPQTLRQYIGQDKAKHNLEVFIEAAKMREETLDHVLLYG
PPGLGKTTLANIIANEMGVNVRTTSGPAIERPGDLAAVLTSLQPGDVLFIDEIHRLHRSI
EEVLYPAMEDFCLDIVIGKGPSARSVRLDLPPFTLVGATTRAGALSAPLRDRFGVLSRLE
YYTVDQLSAIVERTAEVFEVEIDSLAALEIARRARGTPRIANRLLRRVRDFAQVRGNGTV
TMEITQMALELLQVDKLGLDHIDHKLLLGIIEKFHGGPVGLETVSATIGEESHTIEDVYE
PYLLQIGFLQRTPRGRIVTPLAYEHFGMEMPKV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacgtctcctttcaggggaatctgcatatgaagatgcggatttagaatattca
ttacggccacagacgctccgtcagtatattggccaagataaagcgaaacataatttagaa
gtgtttattgaagcggcgaaaatgcgtgaagaaacgttagatcacgtgcttttatatgga
ccaccaggacttggtaaaacgacgcttgcgaatattattgccaatgaaatgggcgtaaat
gttagaacaacttcaggtccagcaatcgaaaggccaggagatttagcagctgtattaaca
tcgcttcaaccaggggatgtattatttattgatgaaattcatcgtttgcatagatcaatt
gaagaagtactatatcctgcgatggaagatttttgccttgatattgtcattggaaaagga
ccgtcagcgcgatctgtacgtttagatttaccgccatttacattagttggagcaacgacg
cgtgcgggagcattatcagcgccattacgtgaccgtttcggtgtactttcaagattagag
tattacacagtagatcagctttctgcgattgtggaacgtacagcagaagtatttgaagtt
gaaattgattcgttagctgcactagaaattgcaagacgtgctcgtggtacacctcgtatt
gcgaatcgtttattacgacgtgtacgagatttcgcacaagttcgtggtaacggaacagtt
acgatggaaattacgcaaatggcattagaattgctgcaagtagataaattaggtctagat
catattgaccataaattattgcttggtattattgaaaaattccacggtggcccagttgga
ctagaaacggtttcggcaacgattggagaagaatctcatacgattgaagatgtgtatgag
ccatatttattacaaattggctttttacaacgaacgccaaggggccggattgtaacgccg
cttgcatatgagcatttcggaatggagatgccaaaagtatga

DBGET integrated database retrieval system