KEGG   Bacillus anthracis A16: A16_46610Help
Entry
A16_46610         CDS       T02998                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
bant  Bacillus anthracis A16
Pathway
bant00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bant01100  Metabolic pathways
bant01110  Biosynthesis of secondary metabolites
bant01130  Biosynthesis of antibiotics
bant01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bant00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A16_46610
Enzymes [BR:bant01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     A16_46610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: AHE91921
LinkDB All DBs
Position
complement(4242210..4243061)
Genome map
AA seq 283 aa AA seqDB search
MIRVGYLGPEATFTNMAVSRFFPEAEHVPYRTIPDCMDAAANGNVDYAVVPLENAIEGSV
NITVDYLVHEQPLSIVGEITVPIQQHLLVHPQYADVWEEVYAVHSHPHAIAQCHKFLNEE
LKGVTARDMTSTSAAAQYVKEHPEEKIAAIANEAAAEKYGLTIVRRGIHTHKNNHTRFLV
LHKKKKAILPNNGENRGEKTTLMITLPADYAGALYQVLSAFAWRKLNLSKIESRPMKTGL
GNYFFLIDVDKAYDEVLLPGVTMELEALGFSVTVLGSYSSYWL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtaggatatttaggaccagaagcaacatttacaaatatggcggtgagtcgt
ttttttccggaagcagagcatgtaccgtatcgaacgattccagattgtatggatgcagct
gcaaatggaaatgtagattatgcagtggtaccactagaaaacgccatagaaggttcagtg
aatataacagttgattacctcgtgcatgagcagccgctttctattgtaggagaaattaca
gtaccaattcagcaacatttacttgtacatccgcagtatgcagacgtgtgggaagaagta
tatgcagtacattctcatccacacgctattgcccaatgtcataaatttttaaatgaagaa
ttaaagggggtaactgcccgagatatgacatcaacaagtgctgctgcacaatatgtgaaa
gaacatcctgaagaaaaaatcgctgccattgcaaatgaagcagctgcagaaaaatacgga
ttaacgattgtaagacgtggcatccatacacataaaaataatcatacacgcttcctcgtg
ctccataagaaaaagaaagcaatactcccaaataacggagaaaatcgcggtgagaaaacg
acgcttatgataacgttacctgctgattatgcaggggcactatatcaagtgttatcagct
ttcgcatggaggaaattaaatttatcaaaaatcgaatctcgtccgatgaaaacaggactt
ggaaattactttttcttaatcgatgtcgataaagcgtacgatgaggtattattgccaggc
gtaacgatggaacttgaagcactcggtttttctgttacggtgctggggagttattcttct
tattggttgtaa

DBGET integrated database retrieval system