KEGG   Bacillus anthracis Vollum: DJ46_3141Help
Entry
DJ46_3141         CDS       T03475                                 

Definition
(GenBank) shikimate kinase family protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
banv  Bacillus anthracis Vollum
Pathway
banv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
banv01100  Metabolic pathways
banv01110  Biosynthesis of secondary metabolites
banv01130  Biosynthesis of antibiotics
banv01230  Biosynthesis of amino acids
Module
banv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:banv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DJ46_3141
Enzymes [BR:banv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     DJ46_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Thymidylate_kin APS_kinase Cytidylate_kin2 AAA_33 AAA_17 dNK AAA Cytidylate_kin CoaE TsaE ABC_tran AAA_24 AAA_22 AAA_28 NTPase_1 cobW AAA_16 PduV-EutP MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AIK62542
LinkDB All DBs
Position
complement(2929651..2930148)
Genome map
AA seq 165 aa AA seqDB search
MKSIYITGYMGAGKTTIGKALSKELHMDVVDTDQKIEEKQGKVIRDIFAEEGEMAFREYE
SEMLCSLPVDNVIITTGGGIVEREENRKWMKENGTVVYLYCDPHVIAERLREDTTRPLFQ
KKDIDAFVTKFESRRAYYEEAHIHIDTTNKSVKQIMNELKEKINE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctatatacataaccggttatatgggagctgggaaaacaacaattggaaaagca
ttaagtaaagaacttcatatggatgttgtagatacagatcaaaaaattgaagagaagcag
ggaaaagtaattcgtgatatttttgccgaagaaggtgaaatggcttttcgggaatatgaa
agtgaaatgttatgttcactacctgttgataatgtaatcattacaactggcggcggaatc
gttgagcgagaggaaaaccgaaaatggatgaaggaaaatggaactgtcgtgtatttatat
tgtgatccacatgtaattgcagaaaggcttcgtgaagatacgacacgtccactatttcag
aagaaagatatagatgcatttgtaacgaaattcgaatcgcgccgagcttattatgaagag
gctcatattcatatcgatacgacgaataagtctgtaaagcaaattatgaatgaattaaaa
gaaaagattaatgaataa

DBGET integrated database retrieval system