KEGG   Bacillus anthracis Vollum: DJ46_3481Help
Entry
DJ46_3481         CDS       T03475                                 

Definition
(GenBank) hlyD secretion family protein
Organism
banv  Bacillus anthracis Vollum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 HlyD HlyD_2 DUF3221
Motif
Other DBs
NCBI-ProteinID: AIK61680
LinkDB All DBs
Position
complement(3249520..3250173)
Genome map
AA seq 217 aa AA seqDB search
MNQFRRMVIINIITLIVLVGGGIGGYYYYNQAENYLKTDNAKIDGKVIPIASPVAGKLTD
WKAEVGKNYNENDKLGAVTVAAANGEQTVDVTIPQNATVVQSNATTNAFVGAGSPIAYAF
DMNNLWVTANIEETDVDDVQKGQDVDVYVDAYPDTTLTGKVEQVGLTTANTFSMLPSSNA
TANYTKVTQVVPVKISLDHSKSVNIVPGMNVTVRIHK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttcgaagaatggtgattatcaacattatcacattaattgtactagttggc
ggcggtattggcggttattactattacaatcaagcggaaaattacttaaaaacagacaat
gcaaaaattgatggaaaggtaattccgattgcatcaccagtagcaggtaaattaactgac
tggaaagctgaagtaggtaagaactacaatgagaatgataaattaggtgctgtcactgta
gcagcagcgaatggagaacaaacagtagatgtaacaattccacaaaatgcaacagttgta
caatcaaacgcaacaacaaatgctttcgttggagcaggtagcccgattgcttatgcattt
gatatgaacaatttatgggtaacagcaaatattgaagaaacagatgttgatgatgttcaa
aaaggtcaagatgtagatgtgtatgtagatgcatacccagatacaacgttaacaggaaaa
gtagagcaagtaggcttaacaacagcgaacacattctctatgttgccatcaagcaacgca
acagcgaactatacgaaagtaacacaagtagtaccagttaaaatttctttagatcatagc
aaatcagtaaatattgttcctggcatgaatgtgacagttcgtattcataagtaa

DBGET integrated database retrieval system