KEGG   Bacillus anthracis Vollum: DJ46_403Help
Entry
DJ46_403          CDS       T03475                                 

Definition
(GenBank) THUMP domain protein
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
banv  Bacillus anthracis Vollum
Brite
KEGG Orthology (KO) [BR:banv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DJ46_403
Enzymes [BR:banv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     DJ46_403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP MTS Cons_hypoth95 Methyltransf_25 Methyltransf_31 N6_N4_Mtase N6_Mtase Methyltransf_11 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: AIK65810
LinkDB All DBs
Position
362367..363506
Genome map
AA seq 379 aa AA seqDB search
MGKVTLIATAAMGIEALVAREVRDLGYECQVENSKVTFEADEKAICRTNLWLRTADRVKI
KVGEFKATTFDELFEKTKALNWGDYIPENGEFPVIGKSLKSELFSVSDCQRIVKKAVVEK
LKTTYKRTTWFEEDGPLFRIEIAMLKDIATLTIDASGVGLHKRGYRVDQGEAPLKETLAA
SLIKLTNWKPDRPFVDPFCGSGTIPIEAALIGQNIAPGFNRGFASDEWGWVGKQNWREAR
QEAEDLANYDQPLQIIGSDIDHRMIRVAQDNAEEVGLGDLITFKQMQVKDFTTKEDYGYV
VTNPPYGERLSEKALVEQLYKEMGQVFRPLDTWSAYVLTSYEAFEKCYGKDASKKRKLFN
GFIRTDYYQYFGKRPPRNS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttactttaatcgcaacagcggcaatgggtattgaagctttagttgcccga
gaagttcgtgaccttggttatgaatgccaagtagaaaacagcaaagtaacatttgaagca
gatgaaaaggcgatttgtcgcacgaatttatggttacgtactgcggaccgtgtgaaaatt
aaagttggcgaatttaaagcgacaacatttgatgagctgtttgagaaaacgaaagcatta
aactggggagattatattccagagaacggtgagttccctgttattggtaaatctttaaaa
tctgagttattcagtgtttcggattgccaacgtatcgttaagaaggctgttgttgaaaaa
ttaaaaacaacatataaacgtacaacttggtttgaagaagatggcccgttattccgtatt
gagattgcaatgctcaaggatattgcaacattaacaattgatgcgagcggtgttggactt
cataaacgtggataccgcgtggatcaaggagaagctcctttaaaagaaacattagctgcg
tctttaattaaattaacaaactggaagccagatcgtcctttcgtggatcctttctgcgga
tcaggtacaattccgattgaagcagcattaattggacaaaatattgcaccaggatttaac
cgtggctttgcatcggatgaatggggctgggttggtaaacaaaactggcgtgaagctcgt
caagaagctgaagacttagcgaactatgatcaaccattgcaaatcattggatcagatatt
gatcatcgtatgattcgagttgctcaagataacgcagaagaagttggtttaggtgattta
attacatttaaacaaatgcaagtaaaagatttcacaacaaaagaggattatggctatgtt
gtaacgaatcctccatacggagaacgtttaagtgaaaaagcacttgttgaacaattgtat
aaagaaatgggacaagtattccgtccattagatacatggtcggcgtatgtattaacaagt
tacgaagcatttgagaagtgctacggaaaagatgcatcgaagaaacgtaaactgtttaac
ggatttattcgtacagattactaccaatacttcggaaaacgtccacctcgtaattcatag

DBGET integrated database retrieval system