KEGG   Bacillus anthracis Vollum: DJ46_4658Help
Entry
DJ46_4658         CDS       T03475                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
banv  Bacillus anthracis Vollum
Pathway
banv00473  D-Alanine metabolism
banv01100  Metabolic pathways
banv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:banv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DJ46_4658 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DJ46_4658 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:banv01011]
    DJ46_4658 (alr)
Enzymes [BR:banv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DJ46_4658 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:banv01011]
 Precursor biosynthesis
  Racemase
   DJ46_4658 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIK65324
LinkDB All DBs
Structure
PDB: 

Position
4341325..4342494
Genome map
AA seq 389 aa AA seqDB search
MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAYGHDYVPVAKIALEAG
ATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVALTVFQKEWVDEAIKLW
DGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELEGVYTHFATADEVETSYF
DKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNAVRIGIAMYGLSPSVEIRP
FLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQGF
EVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQGDEYISATEVAEYSGTINYE
IITTISFRVPRIFIRNGKVVEVINYLNDI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcaccattttatcgtgacacttgggtggaagtggatttagatgccatttat
aacaacgttacacatattaaagaatttatcccgagtgatgtagaaatttttgccgttgtt
aaagggaatgcatatgggcacgattatgtaccggtggctaaaatagcattagaagcgggg
gcgacaaggttagcagttgcgttcttagatgaagctttagtgcttcgaagagctggtatt
actgcgccaattttggtgttaggtccttctcctcctcgtgatataaatgtagctgctgaa
aatgatgtagcattaactgtttttcaaaaggaatgggtagatgaagcaatcaaactttgg
gatggttcgtctacgatgaaataccatattaatttcgatagtggtatggggagaattgga
atacgtgaacgtaaagaattaaaaggatttttaaaaagcttagaaggtgcaccattctta
gagttggaaggagtttatacgcattttgcaacagcagatgaggtggagacttcttacttt
gataagcaatataacacatttttggagcagttaagttggttgaaagaattcggagtggat
cctaagtttgttcatacagctaatagtgctgcaacgctacgttttcaagggattacattt
aatgcagtacgaattggcattgcgatgtatgggttatctccatctgtagaaatacgccct
tttttaccgtttaaattagaaccagcgctatcattgcatacgaaagttgctcatattaaa
caggtgattaaaggggatggaattagttataacgtcacttatcgaacgaaaactgaagaa
tggattgcgaccgttgcaattggttatgcagatggctggcttagaagattacaaggattt
gaagtacttgtaaatggtaaaagggtaccgattgtagggcgagtaacgatggatcaattc
atgattcaccttccttgtgaagtgcctcttggtacgaaagttacactcattggaaggcaa
ggagatgaatatattagcgctacagaggttgcggaatattcagggactattaattatgaa
attattacgacgatcagttttcgtgtgccgagaatatttatacggaatggaaaagttgtg
gaagtaattaattatttgaacgatatatag

DBGET integrated database retrieval system