KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_0113Help
Entry
BAMF_0113         CDS       T01321                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Translation factors [BR:bao03012]
 Eukaryotic Type
  Elongation factors
   BAMF_0113 (tufA)
 Prokaryotic Type
   BAMF_0113 (tufA)
Mitochondrial biogenesis [BR:bao03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BAMF_0113 (tufA)
Exosome [BR:bao04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BAMF_0113 (tufA)
  Exosomal proteins of breast cancer cells
   BAMF_0113 (tufA)
  Exosomal proteins of colorectal cancer cells
   BAMF_0113 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: CBI41239
LinkDB All DBs
Position
133931..135121
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEYEEKILELMAAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIINLPEGVEMVMPGDNTE
MIVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatatcggtacaattggacac
gttgaccatggtaaaacaacattaactgctgctatctcaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgtgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgacactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgtagtattccttaacaaatgcgac
atggtagacgacgaagagcttcttgagcttgttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagttgttaagggttctgctcttaaagctctt
gaaggcgacgctgagtacgaagaaaaaattcttgaacttatggctgcagttgacgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagaaaacagcaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgactatgctgaagctggagacaacatcggtgcactt
cttcgcggtgtagctcgtgaagacatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatcaatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgatcgttgaacttatctctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtacagttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system