KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_0441Help
Entry
BAMF_0441         CDS       T01321                                 

Gene name
alrA
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00473  D-Alanine metabolism
bao01100  Metabolic pathways
bao01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAMF_0441 (alrA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BAMF_0441 (alrA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bao01011]
    BAMF_0441 (alrA)
Enzymes [BR:bao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BAMF_0441 (alrA)
Peptidoglycan biosynthesis and degradation proteins [BR:bao01011]
 Precursor biosynthesis
  Racemase
   BAMF_0441 (alrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBI41567
LinkDB All DBs
Position
479049..480218
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRDTWAEINLSAIKENITHMKKHIGENVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSETVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFERFKKLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQNEIPF
QLKPAFTLHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTAVLI
DGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLETINYEIPCT
ISSRVPRMFLENESIMEVRNPLLQENTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacagcatccttttacagagatacgtgggcggaaatcaacctgtctgcgattaaa
gaaaatattacacatatgaaaaaacacatcggcgaaaacgtccatctcatggcggttgta
aaggcgaacgcgtatggccacggagatttggaagtcgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgttgccatactggatgaagcgatctcattgagaaaacgtggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgaa
tatgacgtaacactgacggggtattctgttgaatggcttcaggaagctgcacgccacctc
ggaagtgaaacagtgccgtttcacctgaaagtcgataccggcatgaacagactcggggtc
aaaacggaggaagaaatccaaagcgtattaaaaatcctcagccaaaacccgggtttagtc
tgtaaaggcgtttttacccattttgctaccgcggatgaaaaaaacagggattatttcctt
ttccaatttgagcgctttaaaaaattgattgctccgcttccgttaaaggaattgatggtg
cattgcgcgaacagcgctgccggccttcgtcttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgccgacattcaaaatgaaattccattt
caattaaagccggcttttacgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcgggacc
gttcccatcggctatgcagacggctggctccgcaagctgagcggtacggccgtgctgatc
gacggcaaacggatgaatattgctggaagaatctgcatggaccaattgatggtagaactg
gaccaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagaaacg
atcacgatggacgaaatcgccgggcggcttgagacgattaattacgagatcccttgtacg
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagaaaatacaagtaagtaa

DBGET integrated database retrieval system