KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_0609Help
Entry
BAMF_0609         CDS       T01321                                 

Gene name
yjdJ
Definition
(GenBank) conserved hypothetical protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4306 Ac110_PIF
Motif
Other DBs
NCBI-ProteinID: CBI41735
LinkDB All DBs
Position
630170..630487
Genome map
AA seq 105 aa AA seqDB search
MKNVFLIVQCAFSVFCFFCLAAVNWYQGSELVSDSFDWNYTAKFSKLLNNTDTITSPEQI
SQLDFFVYSAKHYPLVSGLMIGLFIYFLFSLYLVIKNIRRHKWAE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtttttcttatcgtgcaatgcgcgttttctgttttttgttttttctgcctc
gccgctgtgaattggtatcaggggagtgagcttgtttctgattcgtttgattggaattat
acggctaaattttcaaagctgctgaataatacggatacgatcacaagtcccgaacagata
tcgcagctggatttctttgtgtattctgcgaagcattatccgttagtgagcggtttgatg
atcgggctgtttatttattttttgttttcattgtatttggttataaagaatatccgccgg
cataaatgggctgaatga

DBGET integrated database retrieval system