KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1130Help
Entry
BAMF_1130         CDS       T01321                                 

Gene name
comK
Definition
(GenBank) competence transcription factor (CTF)
  KO
K02250  competence protein ComK
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bao00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAMF_1130 (comK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bao03000]
    BAMF_1130 (comK)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bao02044]
    BAMF_1130 (comK)
Transcription factors [BR:bao03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BAMF_1130 (comK)
Secretion system [BR:bao02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BAMF_1130 (comK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: CBI42256
LinkDB All DBs
Position
1156040..1156618
Genome map
AA seq 192 aa AA seqDB search
MCQKTHAPLESYEVNRSTIAVLPEEIDGKMGSKVIEKDCILYVSMKPIHIIDRSCRYFGS
SYAGRKAGTYEAIKISHKPPIMVDPSNHIFLFPTLSSARPQCGWISHVHVKDFQPTAFDD
TAVTFSNGKTMELEVSYHSFENQVYRTAYLRTTFQDRMGSHIPKRQEFMLYPKEERTKMI
YDFILRELGERY
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtgccagaaaacacacgcacccttagaaagctacgaagtaaatcgttcaaccatcgct
gttttgcctgaggaaatagacggtaaaatggggtcgaaggtcattgaaaaagactgcatt
ctgtatgtcagcatgaagccgattcacatcattgacagaagctgccgctactttggctca
agctatgccgggagaaaagcgggaacgtatgaagcgattaaaatttctcacaagccgccg
attatggtggacccttcaaatcacatctttttattccctacactttcttcagcacggcct
caatgcggctggatatctcacgtgcacgttaaagattttcagccgaccgcatttgatgac
acggcggtcacgttctcaaacggcaaaacgatggagctggaagtatcctaccattctttt
gaaaaccaagtctacagaaccgcctatctcagaaccacttttcaggacaggatgggcagc
catatcccgaagcggcaggaattcatgctgtacccgaaagaagagcggacgaaaatgatc
tacgactttattttgcgggagctgggggagagatattag

DBGET integrated database retrieval system