KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2716Help
Entry
BAMF_2716         CDS       T01321                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00020  Citrate cycle (TCA cycle)
bao00480  Glutathione metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
bao01210  2-Oxocarboxylic acid metabolism
bao01230  Biosynthesis of amino acids
Module
bao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bao_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAMF_2716 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAMF_2716 (icd)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAMF_2716 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CBI43842
LinkDB All DBs
Position
complement(2766251..2767522)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAQTLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSEAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
atcatcccgtttattgaaggcgacggcacaggccctgatatttggaatgccgcttctaaa
gttttggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgaatggctccctgcccaaacgctg
gaagacatcagagagtacttcatcgcgatcaaagggcctctgacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctgagacaggagcttgatttgtttacgtgtctgcgc
cctgtcagatatttcacaggagtgccttctccggtcaaacgccctgaagatacagatatg
gtcattttccgcgaaaatacagaagatatttacgccggaattgagtatgcgaaaggttct
gaagaagttgaaaagctgatcagcttcctgcaaaatgaaatgggcgttaacaaaatccgt
ttccctgaaacatcaggaatcggaatcaagcctgtttctgaagaaggaacaagccgctta
gtcagagccgccattgagtatgcgatcgaaaacggccgtaaatctgttacacttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgct
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacgggaaagaagcagctgataaagcgcagagcgaagcggaagcagcagggaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgcccgagcgaattc
gacgtcgtggcgacaatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaggtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggtgcaaccgaagtgaaatgttcagagttcggtgaagagctcatcaaa
aacatggactga

DBGET integrated database retrieval system