KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2748Help
Entry
BAMF_2748         CDS       T01321                                 

Gene name
ytcI
Definition
(GenBank) putative acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00010  Glycolysis / Gluconeogenesis
bao00620  Pyruvate metabolism
bao00630  Glyoxylate and dicarboxylate metabolism
bao00640  Propanoate metabolism
bao00680  Methane metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_2748 (ytcI)
   00620 Pyruvate metabolism
    BAMF_2748 (ytcI)
   00630 Glyoxylate and dicarboxylate metabolism
    BAMF_2748 (ytcI)
   00640 Propanoate metabolism
    BAMF_2748 (ytcI)
  09102 Energy metabolism
   00680 Methane metabolism
    BAMF_2748 (ytcI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bao01004]
    BAMF_2748 (ytcI)
Enzymes [BR:bao01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAMF_2748 (ytcI)
Lipid biosynthesis proteins [BR:bao01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAMF_2748 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_L6e_N
Motif
Other DBs
NCBI-ProteinID: CBI43874
LinkDB All DBs
Position
complement(2799031..2800713)
Genome map
AA seq 560 aa AA seqDB search
MNKDRRREAIYAYLYCNVLCLCIMGKESEELFVLKREDLIAPKNYNLVNEIEKFSRSKEK
NALIWEDQTGSKKVWTYEKLMEETNKIGARLKGFGFEKGDKLIVMVPRVLEAYAVYLAIL
KAGMVVIPCSEMLRAKDLEYRIKHADVKGVIVYPSFINAFDEVNTDQLVTLSIGENDAGW
KNLLTIEADGDSFQTADTTREDMAFLSYTSGTTGQPKGVVHTHGWAFAHLKTSAGAWLDI
SEDDTVWATAAPGWQKWVWSPLLAVLGSGATGFIYHGRFDAKTYLELLERHQINVFCCTP
TEYRLMAKVEELDKYDLSALHSAVSAGEPLNREVIDVFQKHFGIKVRDGYGQTESTLLVG
VLKNMDIKPGSMGKPTPGNQVEIINDEGEVCETGETGDIAVHLSTPALFKEYYKDPERTK
KQIRGDYFLTGDRAKKDEDGYFWFESRNDDIIVSSGYTIGPFEVEDALVKHPEVKECAVV
ASPDEIRGSIVKAYVVLQNDEKRSDGLVKELQNHVKTITAPYKYPREIEFVESLPKTASA
KIRRVELRQREERLKADKKA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagatagaaggcgggaagcaatttatgcatatctttattgtaacgtcctatgt
ttatgtataatggggaaagaaagtgaggagttgttcgtgttaaaacgagaagatttaatc
gccccaaagaactataaccttgtgaatgaaatcgaaaagttcagccgttccaaagagaag
aacgcgcttatttgggaggatcaaacaggcagcaagaaagtctggacgtatgaaaaactg
atggaagaaacgaataaaatcggagcccgcctgaaaggtttcgggtttgaaaaaggcgat
aagctgattgtcatggttcctagagtgcttgaagcgtatgccgtttatttagcgatctta
aaagcggggatggtcgtcattccttgctcggagatgcttcgtgctaaagatcttgaatac
cggatcaaacacgccgatgttaagggcgttatcgtttatccttcatttataaacgcgttt
gacgaggtgaacaccgatcagctcgtgacattgtctattggtgaaaatgatgccggctgg
aaaaacctcttaaccattgaagcggacggagacagttttcaaacagcagatacaacaaga
gaggatatggcatttttatcctatacttcaggcacgaccggccagcctaaaggcgttgta
catacacacggatgggcctttgcccatttaaaaacatccgccggcgcatggctggatatt
tctgaagacgatacggtctgggccaccgcggcgcccggctggcagaaatgggtgtggagc
ccgctgcttgccgttctgggaagcggcgcaacaggcttcatttatcacggcaggttcgac
gccaaaacgtatttagaactgcttgagcgccatcagattaatgtcttctgctgtacgccg
actgaataccgcctgatggcaaaggtggaggaattggacaaatatgatctttctgctctg
cacagcgcagtttctgcgggtgagccgttaaaccgggaagtcattgacgtattccagaaa
catttcggcattaaagtgagagacggctacggccaaacggagagcaccctgttagtcggc
gtcctgaagaatatggatattaagccgggcagcatggggaaaccgacaccgggaaatcaa
gttgaaattataaacgatgaaggcgaagtatgcgaaacaggcgaaacgggtgatatcgcc
gtgcacttgagcacaccggccttattcaaggaatattataaagaccctgaaagaacgaaa
aagcagattcgcggagattactttcttaccggcgatcgcgcgaaaaaggatgaggacggc
tatttttggtttgaaagccgcaatgatgacattatcgtcagctccggatatacaatcggg
ccttttgaagtagaagacgcgctcgtgaagcatccggaagtgaaagaatgcgccgtcgtg
gcgagtccggacgaaatcagaggttcaatcgtaaaagcctatgtcgttttgcaaaacgat
gaaaagcgcagtgacggacttgtcaaagaactgcaaaaccacgtaaaaacgattacggcg
ccttacaaatatccgagagaaattgaatttgtcgaaagtctgccgaaaacggcgtctgca
aaaatcagacgggtggagctgagacagcgcgaagaacggctgaaggcggataaaaaagca
taa

DBGET integrated database retrieval system