KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3039Help
Entry
BAMF_3039         CDS       T01321                                 

Gene name
yunD
Definition
(GenBank) putative nuclease/nucleotidase/phosphoesterase
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C
Motif
Other DBs
NCBI-ProteinID: CBI44165
LinkDB All DBs
Position
complement(3100297..3101691)
Genome map
AA seq 464 aa AA seqDB search
MLEKLRLYHTNDLHSHFENWPKIVHYIEQKKNEHEKDGEETLVFDIGDHMDRFQMITEAT
FGKANVDLLNRLEIDAAAVGNNEGITLPHDELADLYHHAAFPVIVSNLFDEDGQRPKWAV
PYVIKTLKNGMTAGILGVTVPYYPVYQKLGWTVTDAEKSIQESLDDIKGKADIIILLSHL
GLIDDRAAAETFPDIDVILESHTHHLLEDGQDINGVLLACAEKYGNYVGCVELTLDSETR
TIVSKQASVQKMADWHGESKDTAAFLKEKEREAENLLSVQVANLNEEAGVKWFEESPLPL
LLAEALKNWCGCEVSMVNSGVILGPLKKGPVTKLDLHRICPHPINPVAVRLSGRELQETI
GQAASENMEQLRIKGLGFRGEVMGKMVYAGAEVQTDILEDGVTHLINVKVNGEELDSDRI
YSVAVLDMFTLGKLFPYIRDSKEKQYFMPEFLRDLLAWKLAQQS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttagagaaactccgtttatatcatacgaatgatttgcacagccatttcgaaaattgg
ccgaaaatcgtacattacattgagcagaagaaaaatgagcatgaaaaagacggggaggaa
acactcgtattcgacatcggcgatcatatggaccgatttcaaatgattacagaagcgacc
ttcggcaaagcgaatgtcgacttgttaaaccgtcttgagattgatgcggctgccgtcggg
aataatgaaggaattacgctgcctcacgatgagctggcggatttatatcatcatgccgcg
tttcccgtcattgtatccaacctgtttgacgaggacggacagcggccgaaatgggctgtg
ccgtacgtgatcaaaacgctgaaaaacgggatgaccgccggcatactcggcgtcacggtg
ccgtattatcccgtctatcaaaagctcggctggacggtgacggatgcggaaaaaagcatt
caagaatcactcgacgatatcaagggcaaagcggatatcatcattctgctttcgcatcta
ggcctcatagatgaccgggccgcagcggaaacatttccggacatcgatgtcattcttgaa
tcacatacgcaccaccttcttgaggacgggcaggacataaacggcgtattgcttgcatgt
gcggaaaaatacggaaactatgtcggctgtgtcgagctgacgctggacagtgaaacacga
accatcgtcagcaaacaggcatctgtgcagaaaatggctgattggcacggggaatctaaa
gatacggcggcttttctgaaagagaaagaacgggaagcggaaaatctgctctccgtacag
gtcgccaatctgaatgaagaagccggcgtgaagtggtttgaggaatcaccgctcccgctt
cttttagccgaggcgctgaaaaactggtgcggctgtgaagtcagcatggtgaattcaggc
gtcattttggggcctctaaagaagggacctgtcacaaagcttgatctgcaccgcatctgc
cctcatccgatcaatccggtcgccgtgcgtctttcaggcagggaactccaggaaacaatc
ggccaggctgcctcagaaaacatggagcagctgcggataaaaggcctcggcttccgcggg
gaggtcatgggcaagatggtgtatgccggagccgaggtgcagactgatatccttgaagac
ggtgtaacgcatctcatcaatgtgaaagtgaacggagaagagcttgattcggaccggata
tactcggttgccgttctcgacatgtttacactcggaaagctgttcccgtacatccgcgat
tcgaaagaaaagcaatactttatgccggagtttttaagggatctgctcgcctggaagctt
gcgcagcagtcataa

DBGET integrated database retrieval system