KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3124Help
Entry
BAMF_3124         CDS       T01321                                 

Gene name
fadN
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase (acetoacetyl-CoA)
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00071  Fatty acid degradation
bao00362  Benzoate degradation
bao00650  Butanoate metabolism
bao01100  Metabolic pathways
bao01120  Microbial metabolism in diverse environments
bao01200  Carbon metabolism
bao01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAMF_3124 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAMF_3124 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMF_3124 (fadN)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BAMF_3124 (fadN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: CBI44250
LinkDB All DBs
Position
complement(3181042..3183411)
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEVKKGLTLESPEVRSR
LSRSAMKKLLKQKPAPLTSASNLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLKFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCGIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERTKMKTPALEAAKQAKGAKGKMKALIYADDRAGRLL
WNITSQTLLYSAQLLGEIADDIKAIDDAMKWGFGWELGPFEVWDAIGVRKSAERLEQEGA
KLPGWVKEMLDQGHETFYMKENGTQFYYSDGQYRAVKENPKRVSLQTLKETKGVISKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETERNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLNSGSELMDAAIKTFETIALAKVSGSAHEARD
MQILSAADRVSMNQDHLLHDAKQLAASLYDSGYRPPARKKVRVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaggcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgaggtgaaaaaagggctgacattagaaagcccggaggtccgaagcaga
ctgagccgatcggccatgaaaaaactgctgaagcaaaaaccggcgccgctgacttcagct
tccaatctcgactatataacggcggggaatttggaagatgacgctgctcaattgaaggat
gccgattggattattgaagtcgttgtagaaaatcttgacgtgaaaaaacagattttctca
cttgttgatgaataccggaaacctggaagcatcgtgtccagcaatacgtccggtatttcc
gtaacaaagatggcggaaggcagatctgccgattttaaagctcatttcttaggaacccat
ttctttaatccggcccgttacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctgaagtttatgacttcatttgcagaaaacacgctcgggaaaggtgtcgtt
atcgccaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcttgttagtc
acggtaagagaaatgctttcttccggctgcggcatcggcgaggtggatacggtgaccggg
cctttaatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
acattcgctcatgtggcaaaaaatgtttatgataaagccgacggcgctgaaaaagacatg
tttaagctgccggaatttatgaatgacatgctgaaaaacaattggcttggcagcaaatca
ggtcaaggtttttacaaaaaagaaggtaaaacaatatatgagctcgatccgctaaccatg
acatacggcgagcgcacgaaaatgaaaacacccgctttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttatttatgctgatgaccgcgccggacgactgctt
tggaatattacgtcgcaaaccctcttatactcagctcagcttcttggtgagatcgctgat
gatataaaagcgattgacgacgccatgaaatggggctttggttgggagctcggcccgttt
gaggtgtgggatgccatcggtgtcagaaaatcagcggagcggcttgaacaagaaggcgca
aaactgcccggctgggtgaaagaaatgcttgatcagggtcatgaaacattttatatgaag
gaaaacggaacacaattttactattcagacggccaatacagggcagtaaaagaaaatccg
aaacgcgtcagcctgcaaacgttaaaagaaacaaagggcgtgatcagcaaaaacagcgga
gcaagtttgattgatctcggcgatgatgtcgcgcttctggaatttcatacgaaaagcaat
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaacagagcggaat
tataaaggacttgtcatcggaaaccaaggcagacatttctgcgcgggggcaaaccttgcg
atgattttaatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgccaaacctgttgtggcggcgccgttt
gggatgacactcggcgggggaacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtcttgttgaaaccggcgtcggtcttattccgggcggcggagga
aataaagagctgtacatgaattacttgaacagcggaagcgaactgatggacgcggccatt
aaaacctttgaaaccattgcgcttgccaaggtgtccggttcggcgcacgaagcgcgtgat
atgcagattttgtccgcggctgaccgtgtcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggccgcttccttatatgacagcggataccgcccgccagcccgcaaaaaa
gtgagagtcaccggggaaaccggctgtgcggcgttactgctcggagcagatcaaatgaga
cggtcgggttatttatcagatcacgatatgaagattgcgaagaagctggctcatgtcatt
gccggaggaagagttccgttcggcacggaggtttcagaagaatatttactcgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaagtctcaagcaagaatgcagcatatg
ctggtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system