KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3445Help
Entry
BAMF_3445         CDS       T01321                                 

Gene name
alsS
Definition
(GenBank) alpha-acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00290  Valine, leucine and isoleucine biosynthesis
bao00650  Butanoate metabolism
bao00660  C5-Branched dibasic acid metabolism
bao00770  Pantothenate and CoA biosynthesis
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
bao01210  2-Oxocarboxylic acid metabolism
bao01230  Biosynthesis of amino acids
Module
bao_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bao_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAMF_3445 (alsS)
   00660 C5-Branched dibasic acid metabolism
    BAMF_3445 (alsS)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BAMF_3445 (alsS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BAMF_3445 (alsS)
Enzymes [BR:bao01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BAMF_3445 (alsS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: CBI44571
LinkDB All DBs
Position
complement(3508164..3509879)
Genome map
AA seq 571 aa AA seqDB search
MLAKATNELKTSGKNRGAELVVDCLVEQGVTHVFGIPGAKIDAVFDALKDKGPELVLCRH
EQNAAFMAAAVGRLTGKPGVCLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLK
RTHQSLDNAALFQPITKYSVEVQETGNIPEAVTNAFRAASAGQAGAAFVSFPQDVVNEIT
TVKNVRSVPVPKQGPAPEEAVSAAIAKIQTAKLPVLLVGMKGGRPEAVKQIRKLLAKTKL
PFVETYQGAGTLSRELEDQYFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNVN
GDRDIIHLDEIQADIDHAYQPELELLGDIAATVKQIEHDAVRFDMGSREREVLNELKQIL
SDSEKAPSDHKSGRVHPLQIVQELRSAIDDDVTVTCDIGSHAIWMSRYFRAYEPLKLMIS
NGMQTLGVALPWAIAATLVNPGEKVVSVSGDGGFLFSAMELETAVRLKSPIVHLVWNDST
YDMVAFQQMKKYNRTSCVDFGNIDIVKYAESFGATGLRVESPEQLADVLQKGLNTEGPVI
IDIPVDYSDNVHLSSDMLPKQFKEKMKAKAL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcaaaagcaacaaatgaactaaaaacctctggtaaaaatcgcggggcggagctt
gttgttgattgcttagtggagcaaggtgtcacacatgtttttggcattccgggtgcaaaa
attgatgcagtatttgatgcgttaaaagataaaggacctgaactggttttatgccgtcac
gaacagaacgctgcgtttatggcagcggctgtcggaagactgacaggaaaacctggcgtt
tgtctcgttacttcaggcccgggggcatccaacttggcgaccggcttgttaacggctaat
acagaaggtgatccggtagttgcactggcgggaaacgtgattcgcgcagaccggttaaaa
cggacacaccaatcattggacaatgcggcgctatttcagccgatcacaaaatacagtgta
gaagtacaggaaacagggaatataccagaagcggtaacaaacgccttcagggcagcgtca
gcaggtcaggccggcgcggcttttgtgagctttccgcaggatgttgtgaatgaaatcaca
actgtgaaaaacgtacgcagcgtgccggtgccgaaacaaggccctgcaccggaagaagcg
gtcagtgcggctatcgcgaaaatccagacggcgaaacttcccgttctgttagtcggcatg
aaaggcggaagaccggaggcggtaaaacaaatccgcaaactgcttgctaaaacaaaattg
cctttcgtggaaacgtaccaaggggccggcacattgtccagagaactggaagaccaatat
ttcggccggatcggactgttccgcaaccagccgggcgatcttctgcttgaacaggcggat
gtcgtattaacgatcggttacgatccgattgaatacgatccgaagttctggaatgtaaac
ggcgaccgtgatattatccatcttgacgaaattcaggccgatatcgatcatgcgtatcag
ccggaattagaattactgggcgatatcgccgcaacggtcaaacaaattgagcacgacgcg
gtgagatttgatatgggcagccgtgaacgtgaagtgctgaacgaattaaaacaaatactc
tctgacagcgagaaggctccaagcgaccataaatccggcagagtgcatcctctgcaaatc
gtccaagaactgcgcagcgcaattgatgacgacgtaaccgttacttgtgacatcggctct
cacgccatctggatgtcccgttacttccgcgcttatgagccgctgaagctgatgatcagc
aacggcatgcagacattgggcgtagcgcttccttgggcgattgccgccacattggtgaat
ccgggtgaaaaagtcgtatccgtttcaggagacggaggattcctgttctcggcaatggaa
ctggaaacggcggtccgcttaaaatcgccgatcgttcaccttgtctggaatgacagcaca
tatgatatggtcgcattccagcaaatgaaaaaatataaccgtacatcatgcgtagatttc
ggaaacattgacatcgtaaaatatgcagaaagcttcggcgccaccggcttgcgcgttgag
tcaccggaacagctggcagacgtgctgcaaaaaggcttgaacacagagggtcctgtcatc
atcgacattcctgtcgattacagtgacaacgtccatttatcaagcgacatgcttccgaag
caattcaaagaaaaaatgaaagcaaaagctctctag

DBGET integrated database retrieval system