KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3602
Entry
BAMF_3602         CDS       T01321                                 

Gene name
bacF
Definition
(GenBank) putative aspartate aminotransferase (transaminase A) YwfG
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00998  Biosynthesis of various secondary metabolites - part 2
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
Module
bao_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BAMF_3602 (bacF)
Enzymes [BR:bao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BAMF_3602 (bacF)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: CBI44728
LinkDB
Position
complement(3654159..3655358)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKELEKKGARIINLGQGNPDLPTPPHIVQSLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFEQIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNKFQDHVFVGMFGGLQQAAAAALSGSPEHTERLKRTYQE
RIDFFTDLCEMELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
RGKRYVRISMVAKQGDLREFVLRIQKLGLSFASLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagttggagaaaaagggggcccggatcatcaatctagggcagggg
aatcccgatctccccactccgccgcatatcgttcaatcattgcgggaggctgcgctgaat
ccttcgtatcacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagaatacggtgtatcggtcaatccggagacagaagttgcgctgttc
ggcggagggaaggcgggtttgtacgttttgacgcaatgcctgctgaatcccggcgacatc
gccttagtcccgaaccccggctaccctgagtatttatcaggaatcacaatggccagagcg
gagctgcatgagatgccgcttcatccagagaacggctatctgccggattttgagcagatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcgacagcggatcaggcgttttatgaaaaagcggcggcgtttgctaaaaaacatgac
atccatctcattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagt
tttctccaggcgaaggaagccaagacggtcggcgcggagctgtattcattttcgaaaacc
ttcaatatggcaggctggagaatggcgtttgccgtggggaatgagaagatcattcaggcg
gtcaataaatttcaggatcacgtattcgtcggtatgttcggcggccttcagcaggcggca
gcggcggcgctgtcaggaagccctgaacatacggaacggctgaagcgcacatatcaggaa
cggattgattttttcacggatttatgtgaaatggaattgggctggagcattgaaaaaccg
aaagggactttttatgtctgggctgaaattccgaatgaattcgagtcttcacaccaattt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggaagc
cgcggaaagcgttatgtcagaatatcaatggtggccaagcagggggacttgagggaattc
gttttgcggattcaaaagcttggtttgtcctttgcttcattacaagaaacatcccgctga

DBGET integrated database retrieval system