KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3631Help
Entry
BAMF_3631         CDS       T01321                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bao00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BAMF_3631 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bao03400]
    BAMF_3631 (ung)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BAMF_3631 (ung)
DNA repair and recombination proteins [BR:bao03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BAMF_3631 (ung)
 Prokaryotic type
     BAMF_3631 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: CBI44757
LinkDB All DBs
Position
complement(3683303..3683986)
Genome map
AA seq 227 aa AA seqDB search
MKQLLKDSWWNQLKDEFDKPYYQELREMLKQEYSSQTIYPDSHDIFNALHYTSYEDVKAV
ILGQDPYHGPGQAHGLSFSVQPGVRQPPSLKNIFIELQDDIGCSVPNHGSLVSWAKQGVL
LLNTVLTVRRGQANSHKGKGWERLTDRIIDVVNEREKPIVFILWGRHAQMKKERIDTSKH
VIIESTHPSPFSARNGFFGSRPFSRTNAALEKMGEQPIDWCIPDLPQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagcttttaaaagacagctggtggaatcagctgaaagatgaattcgacaaaccg
tattatcaagagctgagagagatgctgaaacaggaatacagcagccaaacgatttatcct
gacagccatgatatttttaatgccttgcattatacgtcctatgaggatgtaaaagcggtc
attctcggacaagatccgtatcacggtcccggacaggcgcacgggctcagtttttccgtt
cagcccggcgtcagacagccgccgtcattgaaaaatattttcatagagcttcaggatgat
atcggctgctccgtaccgaatcacggatcactcgtcagctgggcgaagcagggagtgctg
ctgttaaacacagtgcttacggttcgccgcggccaggctaattcccacaaaggcaaggga
tgggagcggctcactgaccgcatcattgatgtggtgaatgaaagagaaaagccgattgtc
tttatcctgtggggacgtcacgcacagatgaaaaaagagcgtattgacacatcgaaacac
gttattattgaatcgactcacccgagcccgttttcggcaaggaacggctttttcgggagc
agaccgttttcccgtacaaacgccgcccttgaaaaaatgggggagcagccgattgactgg
tgcatccccgatctgccgcaataa

DBGET integrated database retrieval system