KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_010Help
Entry
BUAP5A_010        CDS       T00820                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:bap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bap03032]
    BUAP5A_010 (gyrB)
   03400 DNA repair and recombination proteins [BR:bap03400]
    BUAP5A_010 (gyrB)
Enzymes [BR:bap01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     BUAP5A_010 (gyrB)
DNA replication proteins [BR:bap03032]
 Prokaryotic type
  DNA Topoisomerases
   BUAP5A_010 (gyrB)
DNA repair and recombination proteins [BR:bap03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BUAP5A_010 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c GyrB_insert Toprim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACL30397
LinkDB All DBs
Position
complement(8911..11322)
Genome map
AA seq 803 aa AA seqDB search
MKNIYDSSNIKILRGLDAVRKRPGMYIGDTDDGSGLHHMVFEIVDNSIDEALSGYCKEII
VTIHSDNSVSVKDDGRGIPTDIHPEENISAAEVIMTVLHSGGKFDNASYQISGGLHGVGI
SVVNALSEKLELIIDKNKKKYQQIYRHGKPENPLSIIGTTDTTGTYIRFWPSYKTFTNNI
KFQYEILSKRLRELSFLNSNIAIYLEDNRTSIKNCYHYKGGIKAFIKFLNAKKTPIHTHI
FYFRSTKDQIELEIAMQWNNSHQENILCFTNNIPQKDGGTHLAGFRSGMTRTLNLHIERE
GYNKKNKTTIIGEDVREGLTAIISIKIPDPKFSSQTKDKLVSSEARSVIESLINENLIEY
LLENPSDSKFIIQKIINAAKVREAARRAREINKKKSILDLGALPGKLSDCQENDPKFSEI
YLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKSKFDKMILSQEVASLITALGCGIGK
NEYNIDKLRYHYIIIMTDADVDGAHIRTLLLTFFYRQLPELIEKGYVYIAQPPLYKLKKG
RKEKYIKNDEEMNTYQIKNALKDLVLKSEDNLIINQKLKKFKKIMSEYHYIQIIMKQSKH
YFPKLVFNELIYHNHLHNLKDIEIVKEWIYTLAENLNKKDNSNNHYSIEIKKNLDKNIFE
PTIKISRYAHYTKYDFKEEFLKSKEYLLITNLGESFKKYFSDKVLIEKSGSTYKIDSIKN
TWKWLIKQSKRGLFIQRYKGLGEMNPEQLWNTTMNPETRNMLQVTIKDAVSANNLFNTLM
GEAVEPRRQFIENNALKAENIDV
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatatacgactcttctaatattaaaattttaagaggattagatgctgttcgt
aaaagaccgggtatgtatattggagatacagatgatggtagtggattgcatcatatggtt
tttgaaatagtagataactcaatagatgaagcgctgtctggttattgcaaagaaataata
gtaactattcattcagacaattcagtttcagtaaaagacgatggtagaggaatacctaca
gatattcatcctgaagaaaatatttcagcggcagaagttattatgacagtattacattca
ggcggcaaatttgataatgcttcatatcaaatatcaggtggattgcacggtgtaggaata
tcagtcgtcaacgctttatcggaaaaattagaactaataatagacaaaaataagaaaaaa
tatcaacaaatatacagacatggaaaaccagaaaatcctctttctatcattggaacaact
gatacaactggtacgtatataagattttggcctagttataaaacttttacaaataatata
aaatttcaatatgaaattttatctaaacgtttgcgtgaactctcttttcttaattcaaac
attgctatttatctcgaagataatagaactagcattaaaaattgctatcattataaaggt
ggcattaaagcatttattaaatttttaaatgcaaaaaagacacctattcatacacatata
ttttattttcgatctacaaaagatcaaatagaactagaaattgctatgcagtggaataat
tctcatcaagagaatatattatgttttactaacaatataccacaaaaagatggcggaaca
cacttagcaggatttcgttccggtatgacgagaacattaaatttacatatagaaagagaa
ggctataataaaaagaacaaaactactataataggtgaagatgtacgtgaaggattaaca
gctattatatcaatcaaaatacctgatccaaaattttcatcgcaaaccaaagataaatta
gtttcttctgaagcgaggtcagtaatagaatcattaattaatgaaaacctgattgaatat
cttttagaaaatccgtctgactcaaaatttattattcaaaaaatcatcaatgcggctaaa
gttagagaagcagcgcgacgagcaagagaaatcaacaaaaaaaagagtatattagattta
ggtgcactgcctgggaaattatctgattgccaagaaaatgatcctaaattctcagaaatt
tatttagtagaaggtgattcggcaggtgggtctgctaaacaaggcagaaacagaaaaaat
caagcaattcttcctcttaaaggaaaaatattgaatgttgaaaaatccaagttcgataaa
atgattttatcacaagaagttgcctctcttatcactgcgttaggatgcgggattggtaaa
aatgaatataatatagataaattaagatatcattatattattataatgactgatgctgat
gtagatggtgcgcatattcgtacacttctcttaacttttttttatcgccaactacctgag
ttaattgaaaaagggtatgtttatattgcacaacctccattatacaaattaaaaaaagga
agaaaagaaaaatatattaaaaatgatgaagaaatgaatacatatcaaattaaaaatgct
ttaaaagatcttgttttaaaaagtgaagataatcttattattaatcaaaaacttaaaaaa
tttaaaaaaattatgtctgaatatcattatattcaaataattatgaaacaaagcaaacac
tattttccaaaattagtatttaatgaattaatctaccacaatcatttacacaatttaaaa
gatatcgaaatagtaaaagaatggatatacacattggctgaaaatctaaataaaaaagat
aacagtaataatcactattcaatagaaattaaaaaaaatttagataaaaatatattcgaa
ccaactataaaaatatctagatatgcacattatacaaaatatgattttaaagaagaattt
ttaaaaagcaaagaatatttattaattactaatttaggtgaaagttttaaaaaatatttt
tcagataaagttttgatagaaaaatctgggtctacttataaaatagatagtataaaaaat
acatggaaatggttaataaaacaatctaaacgcggcttgtttatacaacgatataaagga
ttaggtgaaatgaatccagaacaattatggaatacgacaatgaatcctgaaaccagaaac
atgctacaggtaactatcaaagatgcagtttctgcaaataatttatttaatactctaatg
ggagaagcggttgaacctagaagacaatttatagaaaataatgctttaaaagcagaaaat
attgacgtttaa

DBGET integrated database retrieval system