KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_206Help
Entry
BUAP5A_206        CDS       T00820                                 

Gene name
speE
Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
bap00270  Cysteine and methionine metabolism
bap00330  Arginine and proline metabolism
bap00410  beta-Alanine metabolism
bap00480  Glutathione metabolism
bap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BUAP5A_206 (speE)
   00330 Arginine and proline metabolism
    BUAP5A_206 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BUAP5A_206 (speE)
   00480 Glutathione metabolism
    BUAP5A_206 (speE)
Enzymes [BR:bap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     BUAP5A_206 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12 Chordopox_G2 MTS
Motif
Other DBs
NCBI-ProteinID: ACL30579
UniProt: B8D908
LinkDB All DBs
Position
complement(230172..231032)
Genome map
AA seq 286 aa AA seqDB search
MDHKKTWHEKLYCHLGQYFLIEKMLYKKKTPHHQVMIFKNSVFGKIMVIDDIVQTTERDE
FIYHEMLTHVPIIAHGSIKSVLIIGGGDGGILREVCRYKMIENITMVEIDVNIIDLCKKY
FPNHSNQAYQDSRLNLIIDDGLNFIKRTKEKFDLIISDSTDPIGCGKNLFRSEFYFNCKN
HLEENGIFVAQNGVFFLQKNETILTYKNLKKYFYDTRFYQANVPTYYGGVMVFAWGTNNI
EYRKNSLEKIQIRIKNTKLDFNYYNAKIHISSFYLPQYILNELNES
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatcacaaaaaaacatggcatgaaaagctttattgtcatcttggacaatacttttta
attgaaaaaatgctttataaaaaaaaaacccctcatcatcaagtaatgatttttaagaat
tctgtttttggtaaaatcatggtaatagatgatattgttcaaacaactgaacgcgatgaa
tttatatatcatgaaatgctaactcatgttcctataatcgctcatggttcaataaaaagt
gtattaataataggaggaggtgacggaggcatactacgtgaagtatgtagatataaaatg
attgaaaatatcactatggttgaaatagacgtaaatatcattgatttgtgtaaaaaatat
tttccaaatcatagtaatcaggcctatcaagattctcgtttaaacttgattattgatgat
ggtttgaatttcataaaaagaacaaaagaaaagtttgatttaatcatatcagattccact
gatcctattggctgcggaaagaatttatttcgatcagaattttattttaattgtaaaaat
catcttgaagaaaatggtatttttgtagcacagaacggtgttttttttcttcaaaaaaat
gaaaccattcttacttataaaaatttaaaaaaatatttttatgatacaagattttatcaa
gcgaatgttccaacttattatgggggggtaatggttttcgcgtggggtactaataatata
gaatatcgtaaaaatagtctagaaaaaatacaaatacgtataaaaaatacaaaattagat
tttaattactataatgctaaaattcatataagtagtttttatttacctcaatatattctt
aatgaattaaatgaaagttaa

DBGET integrated database retrieval system