KEGG   Buchnera aphidicola F009 (Myzus persicae): BUMPF009_CDS00356Help
Entry
BUMPF009_CDS00356 CDS       T03020                                 

Gene name
yaet
Definition
(GenBank) Yaet
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bapf  Buchnera aphidicola F009 (Myzus persicae)
Pathway
bapf00061  Fatty acid biosynthesis
bapf00780  Biotin metabolism
bapf01100  Metabolic pathways
bapf01212  Fatty acid metabolism
Module
bapf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bapf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BUMPF009_CDS00356 (yaet)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BUMPF009_CDS00356 (yaet)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bapf01004]
    BUMPF009_CDS00356 (yaet)
Enzymes [BR:bapf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BUMPF009_CDS00356 (yaet)
Lipid biosynthesis proteins [BR:bapf01004]
 Fatty acid synthase
  Component type
   BUMPF009_CDS00356 (yaet)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AHG61863
LinkDB All DBs
Position
263972..264427
Genome map
AA seq 151 aa AA seqDB search
MNCINQTLNIKEILKILPHRYPFLLIDRVLNFQKFKYLKAVKNCTINEPYFQGHFLTESV
FPGVLIIEAMAQASGILIYKSTGLLDINKLHYFVGIDNTRFKKNAIPGDQIFIEVTILKS
DRNILRFKNIAIVDDEIVCKSTIIFAKKSFF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgaattgtataaatcaaactttaaatattaaagaaattttaaaaattttacctcatcgt
tacccttttttacttatagatcgagttttaaattttcaaaaatttaaatatctaaaagca
gtaaaaaattgtactattaatgaaccatattttcaaggtcattttttgacagaatcagtt
tttcctggtgtgttaattattgaagcaatggcccaagcatcaggtattttgatatataaa
agtacaggtttattagatataaacaagttacattattttgtaggaattgataatactcgt
tttaagaaaaatgctattcctggggatcaaatatttatagaagtaactattttaaaatct
gatagaaatattttacgatttaaaaatattgctatagttgatgatgagattgtttgtaaa
tctacaataatttttgctaaaaaatcttttttttaa

DBGET integrated database retrieval system