KEGG   Buchnera aphidicola F009 (Myzus persicae): BUMPF009_CDS00380Help
Entry
BUMPF009_CDS00380 CDS       T03020                                 

Gene name
ddlb
Definition
(GenBank) Ddlb
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bapf  Buchnera aphidicola F009 (Myzus persicae)
Pathway
bapf00550  Peptidoglycan biosynthesis
bapf01100  Metabolic pathways
bapf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bapf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BUMPF009_CDS00380 (ddlb)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUMPF009_CDS00380 (ddlb)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BUMPF009_CDS00380 (ddlb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bapf01011]
    BUMPF009_CDS00380 (ddlb)
Enzymes [BR:bapf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BUMPF009_CDS00380 (ddlb)
Peptidoglycan biosynthesis and degradation proteins [BR:bapf01011]
 Precursor biosynthesis
  Amino acid ligase
   BUMPF009_CDS00380 (ddlb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 RimK ATP-grasp_4 ATP-grasp_3 TTL ATPgrasp_ST ATPgrasp_YheCD ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AHG62092
LinkDB All DBs
Position
complement(235789..236706)
Genome map
AA seq 305 aa AA seqDB search
MNKKIAVLLGGTSSERRISIKSGRAILESLLKSGFQAYPIDISDYSMIKLAKEGFDKAYI
ALHGKGGEDGSIQGVLEYLKIPYTGSGIMSSSVSIDKFRTKLLWKSVHLPIVPDVYIKNN
MKESSYSLAMEKVSQLGFPVLVKPNNQGSSIGITFVSNIKNIHDAIDIAFKYDNHVLIEK
FVKGQEYTISILGEQVLPSIHIVTKNNFYDYNAKYKSLSTEYFCPSGLNIIEENKLKEIA
ISAWKILGCSGCGRIDVILDQKKKFWLLEVNTIPGMTNRSLVPIAAKEVGISFDELVLLI
LKMSN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaatagcagttttattaggtggaacttcttctgaaagaagaatatcaata
aaatcaggtcgtgctattcttgaaagtttgttaaaatctggctttcaagcatatccaatt
gatatatctgattactcaatgataaaactagcaaaagaaggttttgataaagcatatatt
gcattacatggaaaaggtggtgaagatggtagtattcaaggtgttctagaatatttaaag
attccttatacaggaagtggcattatgtcttcatcagtctctatagataaatttagaact
aaattattatggaagtctgtccatcttccaatagtacctgatgtttatataaaaaataat
atgaaagaatcttcatactctcttgcaatggaaaaagtctcacaactaggtttccctgtt
ttagttaaaccaaataatcaaggatctagcattggtattacatttgtttctaatataaaa
aatattcacgatgctatcgatatagcttttaaatatgataatcatgttttaattgaaaaa
tttgtcaaaggacaagaatatacaatttctattcttggagaacaagtattaccttctatt
catattgtaacaaaaaataatttctatgattacaatgctaaatacaaatctctttctacc
gaatatttttgtccaagtggattgaatataatagaagagaataaattaaaagaaatagca
atttctgcatggaaaatattaggatgtagtggatgtggtagaattgatgtaatattagat
caaaagaaaaaattttggttattagaagttaatactatacctggaatgacaaatcgtagt
ttagtaccaatagcagcaaaagaagtaggaatatcatttgacgaattggtattattaatt
ttaaagatgagcaattaa

DBGET integrated database retrieval system