KEGG   Buchnera aphidicola G002 (Myzus persicae): BUMPG002_CDS00332Help
Entry
BUMPG002_CDS00332 CDS       T03021                                 

Gene name
fabi
Definition
(GenBank) Fabi
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bapg  Buchnera aphidicola G002 (Myzus persicae)
Pathway
bapg00061  Fatty acid biosynthesis
bapg00780  Biotin metabolism
bapg01100  Metabolic pathways
bapg01130  Biosynthesis of antibiotics
bapg01212  Fatty acid metabolism
Module
bapg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bapg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BUMPG002_CDS00332 (fabi)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BUMPG002_CDS00332 (fabi)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BUMPG002_CDS00332 (fabi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bapg01004]
    BUMPG002_CDS00332 (fabi)
Enzymes [BR:bapg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BUMPG002_CDS00332 (fabi)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BUMPG002_CDS00332 (fabi)
Lipid biosynthesis proteins [BR:bapg01004]
 Fatty acid synthase
  Component type
   BUMPG002_CDS00332 (fabi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Hrs_helical
Motif
Other DBs
NCBI-ProteinID: AHG61268
LinkDB All DBs
Position
292085..292864
Genome map
AA seq 259 aa AA seqDB search
MGILKGKKILITGIYNSRSIAFGIAQSMYYQQAELGFVCQNEKISNKIKDLVSEMKSNFI
LSCDVSNDENIKKLFFNVSKVWKKFDGLVHCIAYCPKKYLNGDFIDNITRKGFNISHEIS
SYSFLGMVKECRKMLNSFSSLVTLSYLGAKKVVPNYNIMGSAKASLEANVRYMAYTLGEN
NIRVNTISCGPIKTVSSYNIKNFNKINNFHHSSSFIKNLITAENIGNVASFLLSNLSYGI
TGSVIYVDHGVNISSTNSV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggggattttgaagggtaaaaaaattttaattactggtatatataattcaagatcaatt
gcttttggaattgcacaatctatgtattatcaacaagcagaattaggatttgtgtgtcaa
aatgaaaaaataagcaataaaataaaagatttagtttcagaaatgaaatctaatttcata
ttatcatgcgatgtttctaatgatgaaaatattaaaaaattatttttcaacgtaagtaaa
gtatggaagaaattcgatggattagtacattgtattgcatattgtccaaagaagtattta
aatggagattttattgataatattactagaaaaggttttaacatttctcatgaaattagt
tcttatagttttttgggaatggtaaaagaatgtagaaaaatgttaaatagtttttcctct
ttagtcacactgtcttatttaggtgcaaagaaagtagtaccaaattataatattatgggc
tcagcaaaagcttcattagaagccaatgttcgttatatggcttatacattaggagaaaat
aacattagagttaatactatttcatgtggtcctattaaaactgtttcttcttataatatt
aaaaattttaataaaataaataattttcatcattcatcttcttttataaaaaatttgatt
actgctgaaaatataggtaacgttgcatcttttttactatctaatttatcttacggtatt
actggatcagtgatttatgttgatcatggtgttaatattagtagtacaaattctgtttaa

DBGET integrated database retrieval system