KEGG   Buchnera aphidicola G002 (Myzus persicae): BUMPG002_CDS00373Help
Entry
BUMPG002_CDS00373 CDS       T03021                                 

Gene name
ftsi
Definition
(GenBank) Ftsi
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bapg  Buchnera aphidicola G002 (Myzus persicae)
Pathway
bapg00550  Peptidoglycan biosynthesis
bapg01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bapg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUMPG002_CDS00373 (ftsi)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BUMPG002_CDS00373 (ftsi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bapg01011]
    BUMPG002_CDS00373 (ftsi)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bapg03036]
    BUMPG002_CDS00373 (ftsi)
Enzymes [BR:bapg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BUMPG002_CDS00373 (ftsi)
Peptidoglycan biosynthesis and degradation proteins [BR:bapg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BUMPG002_CDS00373 (ftsi)
Chromosome and associated proteins [BR:bapg03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BUMPG002_CDS00373 (ftsi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHG61304
LinkDB All DBs
Position
complement(245740..247455)
Genome map
AA seq 571 aa AA seqDB search
MYKIKKINFFKEKKTKKNIYINWRFFTLCIFILLSLFILTLRVFFLQIINPDPLIHEGDR
RTLRIQSFQSTRGIINDRSGYPLAVTVLVNAVCMDPTIIKNKKNIKKDIRWKALSEVLSI
PLKKIIFHIYKHQKSKFIYLARQITPELGQYIKKLKLPGIFLLEETKRYYPSGKITSQLV
GLTNIDGVGIEGVEKSFNTYLTGKPGKRKIRKDKKGDIIENISLINRSVSNSLTLSIDKK
LQTIVYHKLDKAVKKNNADSGTAVLIDIKTGEVLAMVNSPSYNPNNIHHVNKNNIRNRAI
TDMFEPGSTVKPIVIMEGLKLGIIKKNSIINTQPYYLNKHQIKDVSYHDQLSTTGILQKS
SNVGVSKIALSMPISKLMASYIKFGLGKPTKLGLIGEKNGIFPKKKNWSNLEKATFSFGY
GLMVTPLQLARVYATIGSYGIYRPLSIIKINLPVPGKRIFPKKYVKNVLHMMESVAKPGG
GGIKAAVKGYRIAIKTGTAKKVSIHGHYIKEYVAYTAGIAPASDPRFSLIIMIDNPKGKK
YYGGAVSAPVFGSIMKLILKEMKIQPDDLSN
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaattaaaaaaatcaatttttttaaagaaaaaaaaacaaaaaaaaatatttat
ataaattggcgtttttttacattatgtattttcattttattatctttatttattttaaca
ctgagagtattttttttacaaataattaatccagatccactcatacatgaaggagatcgt
agaacattaagaatacaatcttttcaaagtaccagaggaattattaatgatcgctcagga
tatcctttagcagtcacggtattagttaatgcagtttgtatggatcccacaataattaaa
aataaaaaaaatattaaaaaagatatacgatggaaagctttatcagaagtactttctatt
cccttaaaaaaaattatttttcatatttataaacatcaaaaatcaaaatttatttattta
gctcgtcaaattactcctgaacttggacaatatattaaaaaattaaaattacctggaatt
tttttactagaagaaactaaaagatattatccttctggtaaaattacttctcaactagtt
ggtctaactaatatagatggagtaggaattgaaggagtagaaaaaagttttaatacatat
ttaacaggaaaaccaggtaaaagaaaaataagaaaagataaaaaaggagatattattgaa
aatatatctttaattaatagatctgtatctaatagcttaacactaagtattgataaaaaa
ctacagactattgtatatcataaattggataaagcagttaagaaaaataatgctgattca
ggaactgcagttttaatagatattaaaactggagaagtattagctatggtaaatagtcct
tcatataatcctaataatatccatcatgtgaacaaaaataacattcggaatagagcaatt
acagatatgtttgaacctggttcaacggtcaaaccaatagtaattatggaaggattaaaa
cttggaattattaaaaaaaattcaattataaacacacaaccctattacctaaataaacat
caaataaaagatgtttcatatcatgatcaattaagtactactggaatattacaaaaatca
agtaatgtaggagtatcaaaaattgcattatcaatgccaatttcaaaattaatggcaagt
tatattaaatttggattaggaaaaccaacaaaactaggattgattggcgaaaaaaatggt
atttttcctaaaaaaaaaaattggtctaatctagaaaaagctactttctcatttggatat
gggttaatggttactccacttcagctcgctagagtatatgccactattggtagctatgga
atctatcgtcctctttcaataataaaaattaatcttcctgtacccgggaaaagaattttc
cctaaaaaatatgtcaaaaatgtacttcatatgatggaaagtgttgctaaaccaggtgga
ggtggaataaaagctgcagttaaaggatatcgaattgctatcaaaacaggtactgcaaaa
aaagttagcattcatggacattatattaaagaatatgtagcttatactgcaggaattgca
cctgctagtgatccaagattttcattaattatcatgattgataaccctaaaggaaaaaaa
tattatggaggtgcagtttctgctccagtttttggcagtattatgaagttaatattgaaa
gaaatgaagatacaaccagatgacttatctaattaa

DBGET integrated database retrieval system