KEGG   Bartonella apis: BBC0122_000420Help
Entry
BBC0122_000420    CDS       T05086                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bapi  Bartonella apis
Pathway
bapi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bapi01100  Metabolic pathways
bapi01110  Biosynthesis of secondary metabolites
bapi01130  Biosynthesis of antibiotics
bapi01230  Biosynthesis of amino acids
Module
bapi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bapi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBC0122_000420
Enzymes [BR:bapi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BBC0122_000420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 AAA_22 RsgA_GTPase TsaE VWA_CoxE AAA_29 Mg_chelatase APS_kinase AAA
Motif
Other DBs
NCBI-ProteinID: AQT46183
UniProt: A0A1U9MEL8
LinkDB All DBs
Position
39609..40211
Genome map
AA seq 200 aa AA seqDB search
MAKTAHRLMSHLDGRSLVLVGLMGAGKSTIGKRVATMLELPFHDADYEIEQAARMTIPEL
FESYGEPAFRDLERRVILRLLKDGPMVLATGGGAYMNGETRSAIAEKGISIWLHAELDVL
MERVSHRQNRPLLKRPDPRAFMEKLMAERYPVYALADIRINSRKTRRDVVARDVVRSVES
YLSKSGNSNKGQLKNGKSDS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagcgcatcgtctgatgtctcatctggacgggcgttcgctcgtccttgta
gggcttatgggggcaggcaaatcaacgatcggcaaacgtgtggccactatgctggagctt
ccctttcatgatgccgattacgagatcgagcaggcggcacgcatgacaatacccgaattg
ttcgagtcttatggtgaaccggcttttcgtgatcttgagaggcgtgtgattttacggctg
ttgaaagacgggccgatggtacttgctacgggcggtggtgcctatatgaacggggaaacg
cgcagtgctattgccgaaaagggtatttctatctggcttcatgcggagcttgatgtattg
atggaacgggtttcccaccgtcaaaaccgccctttgttaaaaagacctgatccgcgtgcc
tttatggaaaaacttatggcagaacgttaccctgtttatgctttggccgacattcgcata
aacagccgtaaaacgcgtcgtgacgtggtggcacgcgatgtcgtgcgttcggttgaaagc
tatctttcaaaatccggaaacagcaataaaggacagcttaaaaatggaaaatcagacagt
taa

DBGET integrated database retrieval system