KEGG   Bartonella apis: BBC0122_000950Help
Entry
BBC0122_000950    CDS       T05086                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bapi  Bartonella apis
Pathway
bapi00340  Histidine metabolism
bapi01100  Metabolic pathways
bapi01110  Biosynthesis of secondary metabolites
bapi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bapi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BBC0122_000950
Enzymes [BR:bapi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BBC0122_000950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG Methyltransf_11 Ecm29
Motif
Other DBs
NCBI-ProteinID: AQT46235
UniProt: A0A1U9ME60
LinkDB All DBs
Position
complement(100413..100736)
Genome map
AA seq 107 aa AA seqDB search
MTDFSLHTLEHTIAERAKVDDGSSYTASLVQKGIGRAAKKMGEEAVETVIASIDEDDKHF
ISESADLIYHLLVMWHIRGIKLDDVIKELARRTAQSGLEEKASRKNG
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttagtttgcatacccttgaacatacgattgccgaacgtgcaaaagttgac
gatggcagttcctatacggcaagcctcgtacaaaagggaataggacgtgctgccaaaaaa
atgggtgaggaagcggttgaaactgttatcgcctcgattgatgaagatgacaaacatttc
atcagcgagagcgccgacctgatctatcatttgctggttatgtggcatatacgcggaata
aagcttgatgacgttatcaaagaacttgcaaggcgcacagctcaatccggacttgaggaa
aaggcgtcccgaaagaatggttga

DBGET integrated database retrieval system