KEGG   Bartonella apis: BBC0122_007480Help
Entry
BBC0122_007480    CDS       T05086                                 

Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bapi  Bartonella apis
Brite
Enzymes [BR:bapi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BBC0122_007480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQT46876
UniProt: A0A1U9MGA4
LinkDB All DBs
Position
847002..847598
Genome map
AA seq 198 aa AA seqDB search
MAFELPELPYAYDALQPYMSRETLEYHHDKHHQAYVTNGNKLLKDSGLEGKSLEEIVKAS
FGKNQGLFNNAAQHFNHTHFWKWMKKDGGGKKLPGKLLKAIDSDLGGYDKFREDFLAAGA
AQFGSGWAWLAVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDHLINWDYVLELFEKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgcctgaactaccctatgcttatgatgcgcttcagccttatatgtca
cgcgagacacttgaataccaccatgacaagcaccatcaggcctatgtcaccaacggcaac
aaattgctgaaggattccgggcttgaaggcaaaagccttgaagaaattgtcaaagcaagc
tttggcaaaaatcaggggttgttcaacaacgccgcacaacacttcaatcacacccatttc
tggaaatggatgaaaaaagacggcggtggtaaaaaattgccgggcaaacttctcaaggca
attgatagtgatctgggcggatatgataaattccgtgaagactttcttgccgccggagcg
gctcaattcggttcgggatgggcttggcttgctgtgaaaaacggaaagttggaaatctcg
aaaacaccgaatggtgaaaacccgctggttcatggagcaacgccgattctcggtgtcgac
gtttgggaacactcctattacattgattatcgcaatgcccgtccgaaatatcttgaggca
tttgtcgatcatctgattaattgggattacgtgctggagctttttgaaaaagcctga

DBGET integrated database retrieval system