KEGG   Bartonella apis: BBC0122_020880Help
Entry
BBC0122_020880    CDS       T05086                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bapi  Bartonella apis
Pathway
bapi00473  D-Alanine metabolism
bapi01100  Metabolic pathways
bapi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bapi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBC0122_020880
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BBC0122_020880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bapi01011]
    BBC0122_020880
Enzymes [BR:bapi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BBC0122_020880
Peptidoglycan biosynthesis and degradation proteins [BR:bapi01011]
 Precursor biosynthesis
  Racemase
   BBC0122_020880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AQT48173
UniProt: A0A1U9MKE4
LinkDB All DBs
Position
2496050..2497309
Genome map
AA seq 419 aa AA seqDB search
MLFTYDRQPEMAKSHGNKLKGTNAGIRIGNRIYLGNNEMGEIQNNNKIPTSAYGAILTIN
LDAIVENYNTIKKMVAPAQSAAVVKADAYGLGAQKVAPLLYEAGCRFFFVAELVEAFRLK
DELPTDASIAVLNGILPGTEKITAEAEIIPVLNSWEAILDWQKLCASEAKRLPAIIQIDT
GMCRLGLDNSELYRLVADPSIFNDADIKLVISHLAKSDEENSPANPAQLEAMKKALAKLP
TSKVALAASGGIFLNTGYHFNMVRPGIALYGVDPLGKSPTVIKPVVSLDAHVIQTRHVPA
GSAIGYGGTFITERPSTITTISVGYADGWLRALGNKGSVYFKGVRVPIVGRVSMDSITLD
TTHLGENAPKAGDLVELIGKHQSLDDVARDAGTIPYEILTSLGHRYERIYVKNREGNKK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcacatatgatagacaacctgaaatggcaaaaagccacgggaacaagcttaag
ggaaccaatgcaggcatccggattggcaaccggatttatctgggaaataatgaaatgggt
gaaattcaaaacaacaataaaattccgacatcagcctatggggcaattctcacaatcaat
cttgatgccattgtcgaaaattacaacacgataaaaaaaatggttgctccggcacaaagt
gctgctgttgtcaaagccgacgcttatggccttggtgctcaaaaagtcgcacccttgctt
tatgaagcaggatgccggtttttctttgtagcagaacttgtcgaggcattccggcttaaa
gatgagttgccgacagatgcttccattgctgttttgaatggcattttaccgggaacggaa
aaaataacggcggaagccgaaatcattccggttctgaattcctgggaagctattcttgac
tggcaaaaattatgcgcgagcgaagcaaagcgtttacccgcaatcatccagattgacacc
ggcatgtgccgcttggggcttgataatagcgagctttaccgccttgtcgccgacccgtcg
atttttaacgacgcggatataaaactggttatcagccatttggccaaaagcgacgaggaa
aatagccctgccaatcctgcccagcttgaagcaatgaagaaggcacttgccaaactgcca
acttcaaaagttgcgcttgctgcttccggcgggattttcttgaacaccggttatcatttc
aacatggtgcgccccggaattgccctttacggtgttgacccgctcggcaaaagcccgaca
gttatcaaaccggttgtcagccttgacgcccatgttatccagacacgccatgttcccgct
ggttcggcaatcggctatggtggaacatttataaccgaacggccaagcacaatcacaaca
atatcggtgggctatgccgatggttggttaagggcactcggcaataaaggttcggtttat
ttcaaaggggtgcgcgtgccgattgttggccgcgtttcgatggattccatcacacttgat
acaacgcatcttggtgaaaatgcaccaaaagccggtgatcttgtcgaactcatcggcaag
caccaatcgcttgacgatgttgctcgcgatgccggcacgataccttatgaaattctaacg
tcgctcggtcatcgttacgagcgcatctatgtgaaaaaccgcgagggaaacaaaaaatga

DBGET integrated database retrieval system