KEGG   Buchnera aphidicola W106 (Myzus persicae): BUMPW106_CDS00065Help
Entry
BUMPW106_CDS00065 CDS       T03023                                 

Gene name
arob
Definition
(GenBank) Arob
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
bapw  Buchnera aphidicola W106 (Myzus persicae)
Pathway
bapw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bapw01100  Metabolic pathways
bapw01110  Biosynthesis of secondary metabolites
bapw01130  Biosynthesis of antibiotics
bapw01230  Biosynthesis of amino acids
Module
bapw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bapw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUMPW106_CDS00065 (arob)
Enzymes [BR:bapw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     BUMPW106_CDS00065 (arob)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AHG60444
LinkDB All DBs
Position
complement(575732..576814)
Genome map
AA seq 360 aa AA seqDB search
MEQLKVILGKRSYPISIGAGIIQEDNIFWPLKPGNQAMLVTNKTLANLLKDKVFYHLRKS
GIKIDQVILSDGEQYKSLNEMELIISALLEKKHSRDTTLIALGGGVIGDLTGFAASVYQR
GVRFIQIPTTLLSQVDASIGGKTSVNHLLGKNMIGSFWQPSSVIIDIDCLKTLPYNELVS
GMAEVIKYAIIFDENFFSWLEENIETVLSLDYKSISYCIKKCCELKAKLISLDERENNFR
ALLNLGHTYGHAIEVHAGYGNWLHGEAISVGMIMSARTSELLGYLKKSDFKRILMLLKRT
GLPVKGPKNMSAASYIPYMMRDKKVISGEIRLVLPLSIGKAEIYSNVDKNIILTAIKDSQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagttaaaagttattctaggaaaacgtagttatcctattagtataggtgctgga
attattcaagaagataatatcttctggcctttgaagcctggaaatcaagctatgttagtc
acgaacaaaacattagctaatcttctaaaagataaagttttttatcatttaagaaaatct
ggaataaaaatagatcaagtgattctttctgatggagaacagtataaatcattaaatgaa
atggaattaattatttctgctttattagaaaaaaagcattctcgtgacacaactttaatc
gcattaggtggaggagtaataggcgatttaactggatttgcagcatcagtttatcaaaga
ggtgtgcgttttattcaaattccaactacactgttatctcaagttgatgcttcgattggt
ggaaaaacatctgttaatcatttacttggtaaaaatatgattggttctttttggcaacca
tcttctgttattattgatattgattgtttaaaaacactaccgtataatgagttagtatct
ggtatggcagaagtaattaaatacgcgattatttttgatgaaaattttttttcttggtta
gaagagaatattgaaaccgttttatcacttgattataaatcaatatcttattgtataaaa
aaatgctgcgaactaaaagctaaattaatttctcttgatgaaagagaaaataattttcga
gcattgttaaatttaggtcatacttatggtcatgcgattgaagttcatgctggatatggt
aattggttacatggagaagctatatcagtaggtatgatcatgtctgctcgtacttcagaa
ttacttgggtatttgaaaaaatcagattttaaaagaatacttatgttgttaaaaagaaca
ggtttgccagtaaaaggaccaaaaaatatgtcggcagcttcatatattccctatatgatg
agagataaaaaagtaatctcaggagaaattagattagttttaccattatctattggaaaa
gcagaaatttatagtaatgtagataaaaatatcattttaaccgcgattaaagattctcaa
taa

DBGET integrated database retrieval system