KEGG   Bacillus velezensis CAU B946: BACAU_0294Help
Entry
BACAU_0294        CDS       T01692                                 

Gene name
nasB
Definition
(GenBank) nitrite reductase (NAD(P)H) large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00910  Nitrogen metabolism
baq01100  Metabolic pathways
baq01120  Microbial metabolism in diverse environments
Module
baq_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:baq00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BACAU_0294 (nasB)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BACAU_0294 (nasB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Rubredoxin_C Pyr_redox NIR_SIR_ferr Pyr_redox_3 HI0933_like AlaDh_PNT_C GIDA 3HCDH_N NAD_binding_7 FAD_binding_2 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CCF03828
LinkDB All DBs
Position
complement(319395..321812)
Genome map
AA seq 805 aa AA seqDB search
MGKKQLVLVGNGMAGVRAIEEILRVSKDEFEITIFGAEPHPNYNRILLSKVLQGDTDIQD
ITLNDWNWYKENNIQLYTGETVIKVDTENQTVITDADRIQPYDELILATGSVPFILPIPG
ADKQGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDAAAGRLLQNELEKQGMTFFLEKQTEEILGTDRVEGVRFKDGTSIEADLVVMAVG
IRPNTQLGTESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHICGIETKPYEGSVLSTQLKVSGVEVFSAGDFDESEDKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLDQEAGASMTAAMSDDEIICGC
NGVSKGAIIQAIQEKGCTSTDEIKACTGASRSCGGCKPLVEDILQYTLGSEFDSSAQKEA
ICGCTSLSRDEVVEEIKAKGLSHTREIMNVLGWKTPEGCSKCRPALNYYLGMINPATYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSQDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWAELDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPEKRQELNDRMNETLSVH
KDPWQYFLKDKKASKDLFENVVTTS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaacagctagtccttgttggaaatggaatggccggggtaagagcgattgaa
gaaatactgcgtgtttcaaaagacgaatttgagattacaatattcggggccgaacctcat
cccaactataaccgaatccttctgtcaaaagtgctgcaaggcgataccgacattcaagac
attacgttaaacgattggaactggtacaaagaaaacaacattcagctgtataccggtgaa
acagtcatcaaagtcgacacggaaaaccaaaccgtcatcaccgatgcagacagaatccag
ccttacgatgaactcattctggcgacaggctctgtcccttttatccttccgattccgggc
gcagacaaacaaggcgtcacggcattccgggacataaaagataccgacacgatgctcgcc
gcgtcaaaacaatataaaaaagcagccgtcatcggcggcggactgctgggtttggaagcc
gcgcgcggactgctgaatctcggcatggacgtgtctgtcatccacctcgccccattcctg
atggagcgccagcttgacgcagcggcgggacgcctgctgcaaaacgagttagaaaaacaa
ggcatgacctttttccttgaaaaacaaaccgaagaaattctcggtactgaccgtgtcgaa
ggcgtacgctttaaagacggcacaagcatcgaagctgatctggtcgtcatggcggtcggc
atccgcccgaatacacagcttggcacagaaagcggcatcccggtaaaccgcggaatcatt
gtcaacgattatatgcagactgaaattccgcacatttacgcggtcggtgaatgtgccgag
caccgcggaatcgcatacggtcttgtggcgccgctctatgaacaggcaaaagtgcttgcc
aaacatatttgcggcattgaaacaaaaccgtacgaaggctccgttctctccactcaatta
aaggtatcaggcgtcgaggtcttctctgccggcgactttgatgaatcagaggacaaaaag
gcaataaaagtgttcgatgaacaggacggcatttataaaaaaatcgtcctgaggggcaat
caaattgtcggcgctgttttgttcggagacagcagcgaaggcaaccgcctgttttctatg
attcaaaaagaagcagatatctctgaaacctccaaaatatcaatcttacagcctcttgat
caggaagcaggcgcaagcatgaccgcggcgatgagcgacgatgaaatcatctgcggctgc
aacggcgtttcaaaaggtgcgattattcaagccattcaggaaaaaggctgcacatcaacg
gacgaaatcaaagcatgcaccggggcatcccgttcctgcggaggctgtaaaccgctcgta
gaagacattcttcaatatacactgggctcagaatttgactcatccgcgcaaaaagaagcg
atttgcggctgcacctcactgtcgagagatgaagtcgtagaagaaatcaaagccaaaggg
ctctcacatacaagagaaatcatgaacgtgctcggctggaaaacgccggaaggctgctcc
aaatgccggcctgccctcaactactacttaggcatgattaatccggctacatacgaggat
gacagaacatcccgttttgtgaacgaacggatgcacgccaatattcaaaaagacggaaca
tactcagtcgttccccggatgtacgggggcgtaaccaactctcaagatctccgcaagatc
gccgatgtcgtcgacaaatatgagatcccgctcgttaaaatgaccggcggccagcgaatt
gatctcatcggcgttaaaaaagaagatctgccgaaagtatgggccgagcttgatatgccg
tcaggctacgcgtacggaaaaacactccgcacggtaaaaacgtgcgtaggcgaacaattc
tgccgcttcggcacacaagactccatggcactgggtattgcgcttgagaaaaaattcgaa
gggctcaatacgcctcataaggttaaaatggccgtgtccgcctgcccgcggaactgtgcg
gaatcaggcattaaggaccttggcgttgtcggcatcgacggaggctgggagctttatgtc
ggcggaaacggcggaacccatttgcgcgccggtgatttgctgatgaaagtaaaaacgaat
gaagaagtcttagaatacgcgggtgcttaccttcagtactacagagaaacggcaaactat
ctggagcggacatccgcatggcttgagcgcgtcggtttatctcatgtccaatccgtatta
aacgatccggaaaaacggcaggagctcaacgacagaatgaatgagacactctctgtccac
aaagatccgtggcaatacttccttaaagataaaaaagcttctaaagatctattcgaaaat
gtcgtcacgacttcataa

DBGET integrated database retrieval system