KEGG   Bacillus velezensis CAU B946: BACAU_2035Help
Entry
BACAU_2035        CDS       T01692                                 

Gene name
ypwA
Definition
(GenBank) carboxypeptidase Taq
  KO
K01299  carboxypeptidase Taq [EC:3.4.17.19]
Organism
baq  Bacillus velezensis CAU B946
Brite
KEGG Orthology (KO) [BR:baq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:baq01002]
    BACAU_2035 (ypwA)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.19  carboxypeptidase Taq
     BACAU_2035 (ypwA)
Peptidases and inhibitors [BR:baq01002]
 Metallo peptidases
  Family M32: carboxypeptidase Taq family
   BACAU_2035 (ypwA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M32 HSL_N
Motif
Other DBs
NCBI-ProteinID: CCF05569
LinkDB All DBs
Position
complement(2222888..2224390)
Genome map
AA seq 500 aa AA seqDB search
MDLHTYEKEFFDLLKRVSHYEEAIALMHWDSRTGAPKKGSDDRAESIGQLSADVFQIQTS
DRMKELIDILLAHAEELSEDTVKAAELAKKDYDHNKKIPEDEYREYVILTSKAETAWEEA
RAASDFSMFAPYLEKLIDFNKRFISYWGYEDHSYNALLDIFEPGVTVKVLDQLFSELKEA
IIPLVKKVTTSGNKPDTSFITKTFPKEKQRDLSLYFLKELGYEFDGGRLDETVHPFMTTI
NRGDVRVTTRYDENDFRTAIFGTIHECGHAIYEQNIDEALSGTNLSDGASMGIHESQSLF
YENFIGRNQQFWTAYYEKMVEASPDQFQNVKREDFVRAVNEAKPSFIRIEADELTYPLHI
IIRYEIEKAIFSNEVTVEELPALWNQKYHDYLGIMPPSDAKGILQDVHWAGGDFGYFPSY
ALGYMYAAQLKHTMLEDLPEFDQLIERGDFEPIKQWLTEKVHQHGRRKMPLDIIKDATGE
ELNVQYLIEYLVGKYSNLYL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatttacatacatatgaaaaagagttttttgatctgttaaaaagagtatcccactat
gaagaagccattgcgctcatgcattgggactcaagaacgggagccccgaaaaaaggttct
gatgaccgggcggaaagcatcgggcagctgtcggctgacgtttttcaaatccagacatcc
gaccggatgaaagagctgattgacatccttctcgcgcatgcagaagagctctctgaagat
acagtgaaagctgcagaacttgcaaaaaaagattatgatcataataaaaaaatacctgaa
gatgagtatagagaatatgtcattttgacatcgaaagcggaaacggcttgggaggaggca
agggcagcctctgatttctctatgtttgctccgtaccttgagaagctgattgattttaat
aagcggtttatttcgtattggggctatgaagatcattcatacaacgcattgctcgatatt
ttcgaaccgggcgttacggtaaaggtgctggatcagctgttttctgaattgaaggaagcg
atcattccgcttgtcaaaaaagtgacgacatccggaaataaaccggacacttcctttata
acgaaaacgtttccgaaagaaaaacaaagagatctctccttgtatttcttaaaagaactt
gggtatgagtttgacggcggccgtctggacgaaacggttcatccgtttatgacgacgatc
aaccgcggcgatgtgcgggtgacgaccagatatgacgaaaacgatttccgcacggcgatt
ttcggaacgattcatgaatgcgggcatgcgatttacgagcagaatattgacgaagccctg
agcggaacgaacttatctgacggtgcatccatgggaattcatgaatcccaatcgttattt
tatgaaaactttatcggcagaaatcaacaattctggaccgcctattatgaaaaaatggtt
gaggcttcacctgatcaatttcaaaatgtaaaaagagaggattttgtacgcgccgtaaac
gaggcgaaaccgtcctttatccgaattgaagccgatgagctgacatatccgcttcatatt
attatccgttatgaaattgaaaaagcaattttcagcaatgaagtgacagtggaagaactg
ccggcattgtggaatcaaaaatatcatgattatttaggcattatgccgccatctgacgca
aaaggcattttgcaggacgtacattgggcgggcggcgatttcggctatttcccttcctat
gcgctcggatatatgtatgcggcacagctgaagcataccatgcttgaggatctgcctgaa
tttgatcaattaatagaacggggcgactttgagccgatcaaacaatggctgacagaaaag
gttcatcagcacggaagacgcaaaatgccgcttgatatcataaaagatgcaacgggagaa
gaattgaacgttcaatatctcattgagtatctcgtcggcaaatattcaaatttatattta
taa

DBGET integrated database retrieval system