KEGG   Bacillus velezensis CAU B946: BACAU_2280Help
Entry
BACAU_2280        CDS       T01692                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00061  Fatty acid biosynthesis
baq00620  Pyruvate metabolism
baq00640  Propanoate metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
baq01212  Fatty acid metabolism
Module
baq_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:baq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BACAU_2280 (accC)
   00640 Propanoate metabolism
    BACAU_2280 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BACAU_2280 (accC)
Enzymes [BR:baq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BACAU_2280 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BACAU_2280 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 GARS_A ATP-grasp_5 Oxidored_nitro ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CCF05814
LinkDB All DBs
Position
complement(2495832..2497184)
Genome map
AA seq 450 aa AA seqDB search
MIKKLLIANRGEIAVRIIRACKELGIETVAVYSEADKDALHVQMADEAFCIGPKTSKESY
LNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEELNITFVGPTADAISKMGTKDIAR
DTMQLAGVPIVPGSKGIIKNTEEAVSLAGEIGYPVIIKATAGGGGKGIRVARTEEELIKG
IEITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADNYGNTIHLGERDCSIQRRLQKLLE
ESPSPALDSEIREQMGEAAVKAAKAVGYTGAGTVEFIYDYREQRYYFMEMNTRIQVEHPV
TEMVTGTDLIKEQIKVASGQELSLRQEDVEFNGWAIECRINAENPAKNFMPSPGKINMYL
PPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGTTRDEAVARMKRALSEFVIEGIETTI
PFHLKLLEHETFVSGEFNTKFLETYDVMGS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagctattgatcgccaaccgaggagaaatcgccgtcagaatcatccgggcc
tgcaaagagctgggcattgaaactgtagccgtttattctgaggcagataaagacgccctg
catgtccaaatggccgatgaggctttttgtatcgggccgaaaacatcaaaagaaagctat
ttaaatgtaacgaacatcgtcagcgtcgcaaagctgaccggcacggatgcgattcatccg
ggatacgggtttttagctgaaaacgccgactttgccgagctgtgcgaggaattgaacata
acgtttgtcggccctacggctgacgccatttcaaaaatgggaacaaaagatatcgcgcgc
gacacgatgcagctggcgggcgtgccgattgtgcccggttcaaaaggaatcataaaaaat
accgaagaagcggtttcgcttgcaggtgaaattgggtatcctgtgattataaaagccact
gcgggcggaggcggaaaaggcatccgggtcgcacgcacagaagaagaactgatcaaaggc
attgagattacccagcaggaagccgctacggcattcggaaatccgggtgtgtacatcgag
aagtacatagaagatttccgccatgttgaaattcaggtgcttgcggataattacggaaac
acgatccatctcggagagcgtgactgttctatccaaagacgtctgcaaaaacttcttgaa
gagtcaccgtcacctgcgcttgattctgaaatcagggagcagatgggcgaagctgcggta
aaagcagcgaaggccgtcggttacacgggagccggcacagtagaattcatttatgactac
agagaacagcgctactacttcatggaaatgaacacgcgtattcaagtagagcaccctgtc
acagaaatggtgacgggaacggatctgatcaaagaacagatcaaagtggcatccggacag
gagctttcgctcagacaggaagacgttgaatttaacggctgggcgattgaatgccgcatc
aatgctgaaaatcctgcgaaaaacttcatgccttcacccggtaaaattaacatgtacctg
ccgccgggcggactcggcgtacgcgtggattcagccgcatatcccggctattcgatcccg
ccgtactatgacagtatgattgctaaagtcatcacatacggaacaacgcgtgatgaggca
gtcgcacggatgaaacgcgcgctgagcgaattcgtgattgaaggtattgaaacgacgatt
ccgttccatctgaaactgcttgaacacgaaacatttgtcagcggagagtttaatacaaag
tttttagaaacatatgatgtaatgggctcataa

DBGET integrated database retrieval system