KEGG   Bacillus velezensis CAU B946: BACAU_2973Help
Entry
BACAU_2973        CDS       T01692                                 

Gene name
lytH
Definition
(GenBank) YunA
  KO
K21472  peptidoglycan LD-endopeptidase LytH [EC:3.4.-.-]
Organism
baq  Bacillus velezensis CAU B946
Brite
KEGG Orthology (KO) [BR:baq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:baq01002]
    BACAU_2973 (lytH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:baq01011]
    BACAU_2973 (lytH)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BACAU_2973 (lytH)
Peptidases and inhibitors [BR:baq01002]
 Metallo peptidases
  Family M23
   BACAU_2973 (lytH)
Peptidoglycan biosynthesis and degradation proteins [BR:baq01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   BACAU_2973 (lytH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 SLT_2
Motif
Other DBs
NCBI-ProteinID: CCF06507
LinkDB All DBs
Position
3181292..3182269
Genome map
AA seq 325 aa AA seqDB search
MKVLLSALLLLTVFCPAASGKEQSAPVYGERMQLYRKAEAVTQIPWYVLAAVDQYEENVR
SNRKDLPEKAGIISIYIPDHLWSGPENPNPKDEAPLSIKVFDGIGLDGDGDGKAEVSNDE
DILYTFAQYLAGFGTDLDHIRIGLWNYYRRDQTVGIITEFMTLFKTFGRLDLGEHAFPLP
VKTDYSYRSTWGAARGFGGRRIHEGTDLFAHYGLPVRSTCYGIVEMKGWNRFGGWRIGIR
DINNTYHYFAHLNGFAKGVHKGQIVKPGEVIGSVGSSGYGPPGTAGKFPPHLHYGMYKDN
GRSEWSFDPYPHLRAWERKEIRRKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttctgttatctgctcttctccttttaacagttttctgtccggctgcaagcggg
aaagaacaatcggctcctgtttacggtgaacggatgcagttgtaccgcaaagccgaagca
gtcacgcagattccttggtatgtgcttgcggcggttgatcaatatgaagaaaatgtccgc
tcgaaccgaaaggatctgccggaaaaagcgggaatcatcagcatttatattccggatcat
ttgtggagcgggcctgaaaatccaaatcctaaggacgaggcgcccctcagcattaaagta
tttgacgggatcggcctggacggcgacggcgacggaaaagccgaggtcagcaatgatgag
gatatcctttatacatttgcacagtatttagcgggattcggaacggatcttgaccatatc
cgcatcggcctctggaattattaccgccgtgatcagacggtcggcattatcaccgaattc
atgacactgtttaaaacgttcggccgccttgatctcggagagcacgcttttccgcttccc
gtgaagacggattacagctaccgcagcacatggggcgccgcgcggggtttcggcgggcgc
cggattcacgaaggaacggatctgttcgctcattacggacttcccgtcagatcgacctgc
tacggtattgttgaaatgaagggctggaaccgtttcggcggctggagaatcggcatcagg
gatatcaataacacgtatcactacttcgctcacctgaacggctttgcaaaaggtgtgcat
aaaggccagatcgtcaaacccggagaggtgatcggctctgtcggcagttccggatacgga
ccgccgggcaccgcgggaaaatttccgccgcatcttcactacgggatgtataaagataac
ggcagatcggaatggtcttttgacccgtatccccatttaagggcatgggagcgaaaagaa
atccgcaggaaaaagtaa

DBGET integrated database retrieval system