KEGG   Bacillus velezensis CAU B946: BACAU_3355Help
Entry
BACAU_3355        CDS       T01692                                 

Gene name
ywrE
Definition
(GenBank) putative protein YwrE
Organism
baq  Bacillus velezensis CAU B946
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4181 TMEM238 DUF2651 Ninjurin WBP-1 ABC2_membrane_4
Motif
Other DBs
NCBI-ProteinID: CCF06889
LinkDB All DBs
Position
3567657..3568001
Genome map
AA seq 114 aa AA seqDB search
MDFIQLLIFSAVFILLSLMFQVFAVKVLHFPKAVKKQKPINGTHRLIEITLLITGIAAVT
LFNEMYVFAGVVFMLFCCSGLMEWRHRREEKQYVYDSFYAGLSAALGVLIFFIS
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggatttcattcagttactgattttttcagccgtatttattttgctcagccttatgttt
caagtatttgccgtcaaagttcttcattttccaaaggctgttaaaaagcagaagccgata
aacggcacacatcgattaatcgaaatcacactacttattacgggcatcgcagcggtgact
ttgttcaatgaaatgtacgtatttgcgggagttgttttcatgctattttgctgcagcggc
ttaatggaatggcggcaccggcgggaggaaaagcaatatgtgtacgattcgttttacgca
ggtctttctgccgctcttggcgtgcttatttttttcatcagttag

DBGET integrated database retrieval system